RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_003908
Reference: OH-1004 Chr: Chr01 Coordinates: 113989563-113996002 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4653 bp · LXL04_003908|LXL04_003908|OH1004|cDNA

ATGGAACCACCTGCTGGTGGGCTGCGGGATACATCTGTTATTGTTGTTACACTTGATACGAGTGAGGTATATATAATTGTGAGCTTGTCATCTAGGAAGGACACTGAGGTCGTATATATCGATCCAACAACAGGATCTCTTAGACATGAAAAGAAGCTCGGTTATGACGTTTTCAACTCCCAAGAAGAGGCATTAACCAGCATTACAAATGGTTCAAGATCGGTTTGCAAAAGTGTAATTTATGGCAAAGCCATATTAGG...

CDS

Download CDS FASTA

4653 bp · LXL04_003908|LXL04_003908|OH1004|CDS

ATGGAACCACCTGCTGGTGGGCTGCGGGATACATCTGTTATTGTTGTTACACTTGATACGAGTGAGGTATATATAATTGTGAGCTTGTCATCTAGGAAGGACACTGAGGTCGTATATATCGATCCAACAACAGGATCTCTTAGACATGAAAAGAAGCTCGGTTATGACGTTTTCAACTCCCAAGAAGAGGCATTAACCAGCATTACAAATGGTTCAAGATCGGTTTGCAAAAGTGTAATTTATGGCAAAGCCATATTAGG...

Protein

Download Protein FASTA

1550 aa · LXL04_003908|LXL04_003908|OH1004|PROTEIN

MEPPAGGLRDTSVIVVTLDTSEVYIIVSLSSRKDTEVVYIDPTTGSLRHEKKLGYDVFNSQEEALTSITNGSRSVCKSVIYGKAILGYAVLGSSGLLLVATKLTASIPNLPGGGCVYTVSESQWIKVLLQNPQPQGKGEVKNIQELAELDIDGKHYFCETRDITRPFPSHASVRNPDEEFVWNGWFSSSFTRIGLEQHCVILLQGFAECRSFGSSGQQEGVVALIARRSRLHPGTRYLARGINSCYSTGNEVECEQLVWV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_003908
TK1151 IDTkA01G238790
OH-1004 IDLXL04_003908
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)99.600
Protein coverage (%)TK1151 92.089 / OH-1004 77.355
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_003908
LocationChr01:113989563-113996002 (+)
DescriptionSimilar to SAC9: Probable phosphoinositide phosphatase SAC9
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g59770 Probable phosphoinositide phosphatase that could be involved in stress signaling.
Mutations in the Arabidopsis phosphoinositide phosphatase gene SAC9 lead to overaccumulation of PtdIns(4,5)P2 and constitutive expression of the stress-response pathway.2005 · DOI: 10.1104/pp.105.061317
At1g17340 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). No verified direct reference in this release
At1g22620 Phosphoinositide phosphatase which catalyzes the hydrolysis of phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).
Mutation of SAC1, an Arabidopsis SAC domain phosphoinositide phosphatase, causes alterations in cell morphogenesis, cell wall synthesis, and actin organization.2005 · DOI: 10.1105/tpc.105.031377
At3g43220 The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_003908 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006970 response to osmotic stress Biological Process
GO:0007010 cytoskeleton organization Biological Process
GO:0009409 response to cold Biological Process
GO:0009644 response to high light intensity Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009832 plant-type cell wall biogenesis Biological Process
GO:0036092 phosphatidylinositol-3-phosphate biosynthetic process Biological Process
GO:0046488 phosphatidylinositol metabolic process Biological Process
GO:0046856 phosphatidylinositol dephosphorylation Biological Process
GO:0048015 phosphatidylinositol-mediated signaling Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT1G17340
ath:AT1G22620
ath:AT3G43220
ath:AT3G59770
spo:3361401
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.498
Rank 1 · LXL04_003908 · OH-1004
Nucleus0.295
Rank 2 · LXL04_003908 · OH-1004
Golgi apparatus0.125
Rank 3 · LXL04_003908 · OH-1004
Cell membrane0.114
Rank 4 · LXL04_003908 · OH-1004
Endoplasmic reticulum0.109
Rank 5 · LXL04_003908 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02383.24Syja_N84-385 aa
PF00397.33WW504-534 aa
PF24790.2SAC9_GBDL_1st649-831 aa
PF24791.2SAC9_C8D1038-1104 aa
PF24789.2SAC9_GBDL_2nd1167-1355 aa
PF24765.2SAC9_C1385-1550 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_003908PF02383.24Syja_N843852.9e-41142.5
LXL04_003908PF00397.33WW5045343.7e-1246.8
LXL04_003908PF24790.2SAC9_GBDL_1st6498313.4e-88294.7
LXL04_003908PF24791.2SAC9_C8D103811043.6e-1040.9
LXL04_003908PF24789.2SAC9_GBDL_2nd116713551.3e-80270.5
LXL04_003908PF24765.2SAC9_C138515502e-77259.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q7XZU0Arabidopsis thalianaProbable phosphoinositide phosphatase SAC960.949%Swiss-Protstrong database homology
Q8RW97Arabidopsis thalianaPhosphoinositide phosphatase SAC528.897%Swiss-Protweak database homology
Q7XZU3Arabidopsis thalianaPhosphatidylinositol-3-phosphatase SAC125.323%Swiss-Protweak database homology
Q7XZU2Arabidopsis thalianaPhosphoinositide phosphatase SAC326.071%Swiss-Protweak database homology

JBrowse

View in Genome Browser