TkA01G208270 | RubberDandelionOmics

Gene overview

TkA01G208270

Reference: TK1151 Chr: Chr01 Coordinates: 52988586-52994258 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3562 bp · TkA01G208270|TK1151|cDNA

TTTTTCTCCAGCAACTTGCTAGTGTCCTTTTCTAATTAATTCAACAAATGTACGTTTGCTCAAAAATAAAAATAAAACTCTAAAAAATTTAGCCTTTATGCTAATATATTTCGTTTGCCGTACATAATGGGACCCAAATATAAAATGGTCCAACAAAATGTAGATTTAAGCATTTAGTTATTTTCAAAGAAACTTGCAAAAATAGCTACTTTATACATTTTCTCTCAATAAGGAGAAGATCCATTCTTTCAAAAAGTCTG...

CDS

Download CDS FASTA

2550 bp · TkA01G208270|TK1151|CDS

ATGGTTAGTGGGAATATTTTCCATTTTAGAAAGAATTCATGGCCTCCTGAGGAATATATAAATCGGACGACACTGCAACTGCTTGATTTTGATAGCGGTGCACCTCCTGAACAAGCATGGAGAAGGAAGTTAAACACCCATGCCAGTATTCTCAAGGAATTCAGCATTACTTTCAAGGAAGCAATAAAAATGATCACTCTTGGAATACGATTGTGGTCATATGTAAGAGAAGAAGCCTCTCATGGAAGGAGAGCACCCAT...

Protein

Download Protein FASTA

849 aa · TkA01G208270|TK1151|PROTEIN

MVSGNIFHFRKNSWPPEEYINRTTLQLLDFDSGAPPEQAWRRKLNTHASILKEFSITFKEAIKMITLGIRLWSYVREEASHGRRAPIDPFNREGKPLASQGVPLGGMGSGSITRGFRGEFRQFQILPGTCEASPVMANQFSIFISREGGQKKYASVLSPGQHEGIGKCTDQGLSSWGWNLSGQHSTYHALFPRAWTVYDGEPDPELKVSCRQISPFLPHNYRDSSLPTAVFVYTLVNTGKERAQVSLLLTWANSIGGVSH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G208270`
TK1151 ID	TkA01G208270
OH-1004 ID	LXL04_004060
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 91.487 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G208270`
Location	Chr01:52988586-52994258 (+)
Description	Similar to Gba2: Non-lysosomal glucosylceramidase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004060` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0006680 glucosylceramide catabolic process Biological Process GO:0008203 cholesterol metabolic process Biological Process GO:0008206 bile acid metabolic process Biological Process GO:0009247 glycolipid biosynthetic process Biological Process GO:0016139 glycoside catabolic process Biological Process GO:0030833 regulation of actin filament polymerization Biological Process GO:0031113 regulation of microtubule polymerization Biological Process GO:0046479 glycosphingolipid catabolic process Biological Process GO:0097035 regulation of membrane lipid distribution Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference	dme:Dmel_CG33090 hsa:57704 mmu:230101 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.357

Rank 1 · TkA01G208270 · TK1151

Cell membrane0.238

Rank 2 · TkA01G208270 · TK1151

Endoplasmic reticulum0.223

Rank 3 · TkA01G208270 · TK1151

Nucleus0.200

Rank 4 · TkA01G208270 · TK1151

Golgi apparatus0.126

Rank 5 · TkA01G208270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12215Glyco_hydr_116N101-420 aa

PF17168DUF5127353-427 aa

PF04685GH116_catalytic517-847 aa

PF01204Trehalase688-758 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G208270	`PF12215`	Glyco_hydr_116N	101	420	7.5e-107	358.2
TkA01G208270	`PF17168`	DUF5127	353	427	0.21	12.0
TkA01G208270	`PF04685`	GH116_catalytic	517	847	1.4e-146	489.1
TkA01G208270	`PF01204`	Trehalase	688	758	0.029	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card