TkA01G202180 | RubberDandelionOmics

Gene overview

TkA01G202180

Reference: TK1151 Chr: Chr01 Coordinates: 51500621-51504509 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1693 bp · TkA01G202180|TK1151|cDNA

GATAAATGTTTTATCGTGGTGAAAGAGTTAAAGAATCTAGTAGCAGAAGGGAGAAACGACAATATGTGGGCATGAGCAAGACACCACACAGACTAATCCAATCTTTTCATCTCCCGACGTTATCCATGGAGGACGAGCCATAATCTATTTGGTGCCCTTCTCCTCAGCCACCCTCTCCATATCCTAAAATTTTGCTCTCTTCCCCACCGGAAAATGCAATTTTCTGCAGCTGCAACAGCAAATGGTTCGCCGTATTCCTC...

CDS

Download CDS FASTA

1182 bp · TkA01G202180|TK1151|CDS

ATGCAATTTTCTGCAGCTGCAACAGCAAATGGTTCGCCGTATTCCTCCATCTCTCGCATAGCTTTTCTCTCTAACCTACTCACCACCGATGTTTCCGCATTAAAAACACCACAGCTAAATTGGAACTCAGCAACTAATTTCTGTATTTGTCGAAGCTCTTTAACCCCCAAAAAACCCTCACCGGCGTTTTCCACCCCTAAGGTCTCCACCTCCGACGACAGCTCCAAAACGCAACTCCTTAATCTGATTGACGAAGACGA...

Protein

Download Protein FASTA

393 aa · TkA01G202180|TK1151|PROTEIN

MQFSAAATANGSPYSSISRIAFLSNLLTTDVSALKTPQLNWNSATNFCICRSSLTPKKPSPAFSTPKVSTSDDSSKTQLLNLIDEDEDVVRQARRSADWKAARAHYENGIEYQGRVEGSNGGGLLIRFYSLVGFLPYPQLSPSHSCKEPDKSIQEIAKALTGTLISVKVIHAEEEKRKLIFSEKEATWSKYSNSVKVGNIYEARVGSVEDYGAFAHLRFPDGSYHITGLVHVSEVSWDLVQDVRDILNEGDEVKVKVIGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G202180`
TK1151 ID	TkA01G202180
OH-1004 ID	LXL04_004105
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G202180`
Location	Chr01:51500621-51504509 (-)
Description	Similar to RPS1: 30S ribosomal protein S1, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004105` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006412 translation Biological Process GO:0005840 ribosome Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0009579 thylakoid Cellular Component GO:0022627 cytosolic small ribosomal subunit Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003729 mRNA binding Molecular Function GO:0003735 structural constituent of ribosome Molecular Function
KEGG gene cross-reference	ath:AT5G30510 bsu:BSU22880 syn:slr1356 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.972

Rank 1 · TkA01G202180 · TK1151

Mitochondrion0.033

Rank 2 · TkA01G202180 · TK1151

Nucleus0.032

Rank 3 · TkA01G202180 · TK1151

Cytoplasm0.024

Rank 4 · TkA01G202180 · TK1151

Peroxisome0.013

Rank 5 · TkA01G202180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23459S1_RRP5107-145 aa

PF00575S1108-182 aa

PF18942DUF5689152-240 aa

PF29086OB_PDCD11157-177 aa

PF29086OB_PDCD11190-274 aa

PF24685OB_RRP5_4th193-262 aa

PF00575S1195-272 aa

PF23459S1_RRP5198-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G202180	`PF23459`	S1_RRP5	107	145	0.00063	21.0
TkA01G202180	`PF00575`	S1	108	182	2.5e-21	76.5
TkA01G202180	`PF18942`	DUF5689	152	240	0.0015	19.2
TkA01G202180	`PF29086`	OB_PDCD11	157	177	1.5e-05	25.5
TkA01G202180	`PF29086`	OB_PDCD11	190	274	1.5e-05	25.5
TkA01G202180	`PF24685`	OB_RRP5_4th	193	262	0.00023	21.8
TkA01G202180	`PF00575`	S1	195	272	2.5e-21	76.5
TkA01G202180	`PF23459`	S1_RRP5	198	270	0.00063	21.0
TkA01G202180	`PF18942`	DUF5689	247	274	0.0015	19.2
TkA01G202180	`PF09876`	DUF2103	344	379	0.2	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card