TkA01G199030 | RubberDandelionOmics

Gene overview

TkA01G199030

Reference: TK1151 Chr: Chr01 Coordinates: 50738975-50739448 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkA01G199030|TK1151|cDNA

ATGATATTACTCCTCGCGGATCTTGTTATGGTAGTTCTCGAACTCTCAAAAACTCTGGTTTCATGCCCAAAGAGCAGGAGAATAAACAAGAAAGTAGATATGTGGTACCATTGGGTAGGAATTGGAATCTTGGTGATTCTTGCTATGAAGAGTGTGGCATTGGTAGTGGGGTGTGGGAGGTCATTTTTTAAACGCCCGGGTCTAGTAGCCGATGGTGTGGTGTTGATTGGGGCGTTGGTGTGTGAGGTTTTGGTTGAAAG...

CDS

Download CDS FASTA

474 bp · TkA01G199030|TK1151|CDS

ATGATATTACTCCTCGCGGATCTTGTTATGGTAGTTCTCGAACTCTCAAAAACTCTGGTTTCATGCCCAAAGAGCAGGAGAATAAACAAGAAAGTAGATATGTGGTACCATTGGGTAGGAATTGGAATCTTGGTGATTCTTGCTATGAAGAGTGTGGCATTGGTAGTGGGGTGTGGGAGGTCATTTTTTAAACGCCCGGGTCTAGTAGCCGATGGTGTGGTGTTGATTGGGGCGTTGGTGTGTGAGGTTTTGGTTGAAAG...

Protein

Download Protein FASTA

157 aa · TkA01G199030|TK1151|PROTEIN

MILLLADLVMVVLELSKTLVSCPKSRRINKKVDMWYHWVGIGILVILAMKSVALVVGCGRSFFKRPGLVADGVVLIGALVCEVLVERVGVGLIVVVSLWRVLRVVESVFELSDAAIEVQITSILCQFELLKQENENLRGIVAEKEKIIDELQEELDK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G199030`
TK1151 ID	TkA01G199030
OH-1004 ID	LXL04_004129
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 67.094 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G199030`
Location	Chr01:50738975-50739448 (-)
Description	Similar to HVCN1: Voltage-gated hydrogen channel 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004129` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009268 response to pH Biological Process GO:0010043 response to zinc ion Biological Process GO:0051453 regulation of intracellular pH Biological Process GO:0071294 cellular response to zinc ion Biological Process GO:0071467 cellular response to pH Biological Process GO:1902600 proton transmembrane transport Biological Process GO:1903426 regulation of reactive oxygen species biosynthetic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0030670 phagocytic vesicle membrane Cellular Component GO:0034702 monoatomic ion channel complex Cellular Component GO:0030171 voltage-gated proton channel activity Molecular Function
KEGG gene cross-reference	gga:416871 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.318

Rank 1 · TkA01G199030 · TK1151

Endoplasmic reticulum0.258

Rank 2 · TkA01G199030 · TK1151

Golgi apparatus0.232

Rank 3 · TkA01G199030 · TK1151

Lysosome / Vacuole0.213

Rank 4 · TkA01G199030 · TK1151

Cytoplasm0.192

Rank 5 · TkA01G199030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans2-106 aa

PF22954DUF70272-81 aa

PF04039MnhB23-99 aa

PF27193VcrB34-85 aa

PF28907ZapB_rel116-156 aa

PF29964NEJ1_C120-155 aa

PF27636CCPG1_N121-157 aa

PF30966At4g38062_C128-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G199030	`PF00520`	Ion_trans	2	106	0.0019	18.2
TkA01G199030	`PF22954`	DUF7027	2	81	0.69	10.6
TkA01G199030	`PF04039`	MnhB	23	99	0.0013	19.7
TkA01G199030	`PF27193`	VcrB	34	85	0.027	15.5
TkA01G199030	`PF28907`	ZapB_rel	116	156	0.00012	23.3
TkA01G199030	`PF29964`	NEJ1_C	120	155	0.083	13.3
TkA01G199030	`PF27636`	CCPG1_N	121	157	0.03	15.6
TkA01G199030	`PF30966`	At4g38062_C	128	154	0.0062	16.3
TkA01G199030	`PF16808`	PKcGMP_CC	141	157	0.019	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card