TkA01G197160 | RubberDandelionOmics

Gene overview

TkA01G197160

Reference: TK1151 Chr: Chr01 Coordinates: 50278921-50281593 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1362 bp · TkA01G197160|TK1151|cDNA

ATGAGAACGATTTCAGCTGATCCTGACGAAATCGATGTCTTTCAACGTCACGTTGAAGAAGATGAATATATACCGACATTTCAACAGGAAGACGACGAATCTTCTGATGATTACGACGAAACAGATAACGTTTCAGGTTCAGTTTCTTCTTCCTCTATTGACTCAAACTCCAGCAGTACCACAAGCAGATTTGTTGCAGAGAATAGTCACAACACGGATGTTCATGATGTTAAACCTGATGTACCTGATGAATTCAAACC...

CDS

Download CDS FASTA

1362 bp · TkA01G197160|TK1151|CDS

ATGAGAACGATTTCAGCTGATCCTGACGAAATCGATGTCTTTCAACGTCACGTTGAAGAAGATGAATATATACCGACATTTCAACAGGAAGACGACGAATCTTCTGATGATTACGACGAAACAGATAACGTTTCAGGTTCAGTTTCTTCTTCCTCTATTGACTCAAACTCCAGCAGTACCACAAGCAGATTTGTTGCAGAGAATAGTCACAACACGGATGTTCATGATGTTAAACCTGATGTACCTGATGAATTCAAACC...

Protein

Download Protein FASTA

453 aa · TkA01G197160|TK1151|PROTEIN

MRTISADPDEIDVFQRHVEEDEYIPTFQQEDDESSDDYDETDNVSGSVSSSSIDSNSSSTTSRFVAENSHNTDVHDVKPDVPDEFKPNKLMRFRTVNDAIDMYRSYAEKAGFDVRLNTERKSGERVIHKYLVCHRNGKPPNKSVEIKNKRNTHYRSTDCKEKIVIKHIDGSTDYRFDKFEELHNHEKIISDFVFNLKNEPYDAIMITADGRTIFSYIFESLFPDQHIGYGVIDIWVHILNLKELERDVINSPHRLFIPVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G197160`
TK1151 ID	TkA01G197160
OH-1004 ID	LXL04_002409
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.400
Protein coverage (%)	TK1151 98.455 / OH-1004 41.801 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G197160`
Location	Chr01:50278921-50281593 (-)
Description	Similar to NPR1: BTB/POZ domain and ankyrin repeat-containing protein NPR1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002409` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001666 response to hypoxia Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006952 defense response Biological Process GO:0009408 response to heat Biological Process GO:0009414 response to water deprivation Biological Process GO:0009611 response to wounding Biological Process GO:0009617 response to bacterium Biological Process GO:0009625 response to insect Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009627 systemic acquired resistance Biological Process GO:0009651 response to salt stress Biological Process GO:0009682 induced systemic resistance Biological Process
KEGG gene cross-reference	ath:AT1G64280 ath:AT4G26120 dosa:Os01g0194300 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · TkA01G197160 · TK1151

Cytoplasm0.198

Rank 2 · TkA01G197160 · TK1151

Mitochondrion0.024

Rank 3 · TkA01G197160 · TK1151

Cell membrane0.015

Rank 4 · TkA01G197160 · TK1151

Extracellular0.008

Rank 5 · TkA01G197160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02902Peptidase_C4854-93 aa

PF11032ApoM89-207 aa

PF03101FAR1102-186 aa

PF02902Peptidase_C48263-393 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G197160	`PF02902`	Peptidase_C48	54	93	9.6e-08	32.8
TkA01G197160	`PF11032`	ApoM	89	207	0.15	12.5
TkA01G197160	`PF03101`	FAR1	102	186	1.2e-12	49.1
TkA01G197160	`PF02902`	Peptidase_C48	263	393	9.6e-08	32.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card