RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G194810
Reference: TK1151 Chr: Chr01 Coordinates: 49787227-49793938 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2297 bp · TkA01G194810|TK1151|cDNA

AATATTTAGTAAGTTGATAAGTGCATCTTTTCTCTTTACGTGATTTAATATGATTAACATAACTTTGGTGAACAGTTGTCCCTGTACAATATGGCCTCAACTAAGAGATGCTGAAAATAATAAAACAATTGCTGCATTTGAGCTACCACTAGGGAATACACGATCTGTTAAAACTCTTGCTGACTTTCATGGTTATTTGTATGGTTTGACCAGCTGCCAAATTAACAATGGATCCGGTTGTAAAAACACAAATGAACCTG...

CDS

Download CDS FASTA

2166 bp · TkA01G194810|TK1151|CDS

ATGATTAACATAACTTTGGTGAACAGTTGTCCCTGTACAATATGGCCTCAACTAAGAGATGCTGAAAATAATAAAACAATTGCTGCATTTGAGCTACCACTAGGGAATACACGATCTGTTAAAACTCTTGCTGACTTTCATGGTTATTTGTATGGTTTGACCAGCTGCCAAATTAACAATGGATCCGGTTGTAAAAACACAAATGAACCTGTGACCATAGTTGTATTCAAGCTCCAAGTCAACGGAGCCGCTGAATATTA...

Protein

Download Protein FASTA

721 aa · TkA01G194810|TK1151|PROTEIN

MINITLVNSCPCTIWPQLRDAENNKTIAAFELPLGNTRSVKTLADFHGYLYGLTSCQINNGSGCKNTNEPVTIVVFKLQVNGAAEYYVDNMDGFNLPVSVDAIGGSGSGIYKCAKAGCIGQMKGWCPPELKVQGGDGCCSACNVFHAPEYCCSLSFSTPSTCKPTSYAKAFQRVCPRSRTLPYNTDNSTSIFTCEGADYIVRFCPAAGTFSTIQVGGQLRCTDRLTSTNGTFTLGFYGVHFGSLGIWYSNDENNKVWVAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G194810
TK1151 IDTkA01G194810
OH-1004 IDLXL04_029217
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)33.300
Protein coverage (%)TK1151 94.730 / OH-1004 50.397
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G194810
LocationChr01:49787227-49793938 (-)
DescriptionSimilar to CES101: G-type lectin S-receptor-like serine/threonine-protein kinase CES101
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g11300 G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300. No verified direct reference in this release
At4g23180 Cysteine-rich receptor-like protein kinase 10. No verified direct reference in this release
At4g23260 Cysteine-rich receptor-like protein kinase 18. No verified direct reference in this release
At4g23310 Putative cysteine-rich receptor-like protein kinase 23. No verified direct reference in this release
At4g23240 Putative cysteine-rich receptor-like protein kinase 16. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_029217 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006955 immune response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009620 response to fungus Biological Process
GO:0045087 innate immune response Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005516 calmodulin binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030246 carbohydrate binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G67520
ath:AT3G16030
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.821
Rank 1 · TkA01G194810 · TK1151
Cytoplasm0.117
Rank 2 · TkA01G194810 · TK1151
Nucleus0.078
Rank 3 · TkA01G194810 · TK1151
Endoplasmic reticulum0.071
Rank 4 · TkA01G194810 · TK1151
Lysosome / Vacuole0.030
Rank 5 · TkA01G194810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00314Thaumatin8-205 aa
PF01636APH186-209 aa
PF24498Ig_TMEM131L_3242-328 aa
PF01453B_lectin256-329 aa
PF27946C1orf162340-382 aa
PF28423Epiregulin_C352-370 aa
PF00069Pkinase410-678 aa
PF03109ABC1411-437 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G194810PF00314Thaumatin82055.5e-39134.7
TkA01G194810PF01636APH1862090.0002821.4
TkA01G194810PF24498Ig_TMEM131L_32423280.2512.1
TkA01G194810PF01453B_lectin2563290.02715.6
TkA01G194810PF27946C1orf1623403820.1113.1
TkA01G194810PF28423Epiregulin_C3523700.06313.8
TkA01G194810PF00069Pkinase4106787.8e-45154.0
TkA01G194810PF03109ABC14114378.9e-0522.5
TkA01G194810PF07714PK_Tyr_Ser-Thr4126798.2e-44150.6
TkA01G194810PF03109ABC14795608.9e-0522.5
TkA01G194810PF06293Kdo4805530.05113.7
TkA01G194810PF01636APH4955570.0002821.4
TkA01G194810PF12330Haspin_kinase5035590.08112.7
TkA01G194810PF07387Seadorna_VP75105540.08812.5
TkA01G194810PF17667Pkinase_fungal5276010.0003920.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SXB4Arabidopsis thalianasp|Q9SXB4|Y1130_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g1130039.500%Swiss-ProtMedium
Q8GYA4Arabidopsis thalianasp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase 1045.900%Swiss-ProtMedium
Q8RX80Arabidopsis thalianasp|Q8RX80|CRK18_ARATH Cysteine-rich receptor-like protein kinase 1844.500%Swiss-ProtMedium
O65482Arabidopsis thalianasp|O65482|CRK23_ARATH Putative cysteine-rich receptor-like protein kinase 2343.500%Swiss-ProtMedium
O65476Arabidopsis thalianasp|O65476|CRK16_ARATH Putative cysteine-rich receptor-like protein kinase 1644.900%Swiss-ProtMedium

JBrowse

View in Genome Browser