TkA01G192120 | RubberDandelionOmics

Gene overview

TkA01G192120

Reference: TK1151 Chr: Chr01 Coordinates: 49205903-49210051 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2231 bp · TkA01G192120|TK1151|cDNA

ACTTTATAAAATCGTTGTTTGCGTTTCACAGATAGTCGTCAATTCTCACATGCTCAGGTATTCAACAAGTTTTCTGAGAATTGTCGTGGAGAAGAATACTAATTGCTAAATTTTCTCCGCTTAACAACCTCCGGAATCTCTGAAAAACCGCCTCATTACCAACTGATAAACCTCCACAAAACTTTTATCATTTCAAAATTTTGGAATCTCGATAATCACTCAACTTCTTACTGGTTTTAGCAAGTTGTCGGTTGTCTGTT...

CDS

Download CDS FASTA

384 bp · TkA01G192120|TK1151|CDS

ATGGAACTAATTCATGTGGATTACCCTGTAATGGAGGTTCCTGGGACATGGAGATGGATGCTTGGAGTGGCTGCTGTCCCTGCTATTGTTCAATTTCTATTGATGTTATTGTTACCCGAGTCTCCAAGATGGCTTTACATGAAGAAGAGTAAATCCGAGGCTATTGTCGTCCTGTCAAAGATATATGATCCATACCGATTAGAAGAAGAACTCGACCAGCTTGCATCTGCTTTAGAAGAAGAAAAACACCGCAAAAACGC...

Protein

Download Protein FASTA

127 aa · TkA01G192120|TK1151|PROTEIN

MELIHVDYPVMEVPGTWRWMLGVAAVPAIVQFLLMLLLPESPRWLYMKKSKSEAIVVLSKIYDPYRLEEELDQLASALEEEKHRKNAVSYLDVFRIKKSGLHSSPELVFKHFNSLLELTPSCITAQP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G192120`
TK1151 ID	TkA01G192120
OH-1004 ID	LXL04_004169
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 79.528 / OH-1004 19.423 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G192120

Location Chr01:49205903-49210051 (-)

Description Similar to INT1: Inositol transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g43330`	Vacuolar inositol-proton symporter involved in the release of myo-inositol from vacuoles.	Functional and physiological characterization of Arabidopsis INOSITOL TRANSPORTER1, a novel tonoplast-localized transporter for myo-inositol.2008 · DOI: 10.1105/tpc.107.055632
`At4g16480`	Plasma membrane inositol-proton symporter.	Arabidopsis INOSITOL TRANSPORTER4 mediates high-affinity H+ symport of myoinositol across the plasma membrane.2006 · DOI: 10.1104/pp.106.077123 Arabidopsis INOSITOL TRANSPORTER2 mediates H+ symport of different inositol epimers and derivatives across the plasma membrane.2007 · DOI: 10.1104/pp.107.109033
`At2g35740`	Plasma membrane inositol-proton symporter.	Arabidopsis INOSITOL TRANSPORTER2 mediates H+ symport of different inositol epimers and derivatives across the plasma membrane.2007 · DOI: 10.1104/pp.107.109033
`At1g30220`	Plasma membrane inositol-proton symporter.	Arabidopsis INOSITOL TRANSPORTER2 mediates H+ symport of different inositol epimers and derivatives across the plasma membrane.2007 · DOI: 10.1104/pp.107.109033

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004169 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015798 myo-inositol transport Biological Process

GO:0023052 signaling Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005366 myo-inositol:proton symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G30220

ath:AT2G35740

ath:AT2G43330

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.440

Rank 1 · TkA01G192120 · TK1151

Golgi apparatus0.208

Rank 2 · TkA01G192120 · TK1151

Cell membrane0.192

Rank 3 · TkA01G192120 · TK1151

Cytoplasm0.169

Rank 4 · TkA01G192120 · TK1151

Lysosome / Vacuole0.134

Rank 5 · TkA01G192120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr16-96 aa

PF25826DUF795242-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G192120	`PF00083`	Sugar_tr	16	96	1.3e-16	61.3
TkA01G192120	`PF25826`	DUF7952	42	95	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZR6`	Arabidopsis thaliana	sp\|Q8VZR6\|INT1_ARATH Inositol transporter 1	64.400%	Swiss-Prot	High
`O23492`	Arabidopsis thaliana	sp\|O23492\|INT4_ARATH Inositol transporter 4	48.400%	Swiss-Prot	Medium
`Q9ZQP6`	Arabidopsis thaliana	sp\|Q9ZQP6\|INT3_ARATH Probable inositol transporter 3	44.200%	Swiss-Prot	Medium
`Q9C757`	Arabidopsis thaliana	sp\|Q9C757\|INT2_ARATH Probable inositol transporter 2	37.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card