RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G174100
Reference: TK1151 Chr: Chr01 Coordinates: 44557592-44562625 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3054 bp · TkA01G174100|TK1151|cDNA

GTTTTAGTAAATTTTATTGATAATCAATGGATGCTTACAGCAGATTCCCTGCTATTAGTGATAATCCCTTCAACTTTTGGGGCCAACCCACGTTAGCACACTAGAGCAGTAGAGCAATTCTGCTCGGCCTCTCGGTCCCCCAAACGCATTTCACGCCCCCCTTCGCTGATAACAAGCAACGACGTCGATCATACGGTGCATTAGCAGGTGATGGTGGCGGACGGTTGTTTACAAGCGGTGTAACATGGAAACTTCTGATT...

CDS

Download CDS FASTA

2646 bp · TkA01G174100|TK1151|CDS

ATGGAAACTTCTGATTCAGATGAGCCTGAGAAAAAGCGGCCTCATCTGAACAATTCCGACATGGCACGTCACCCTAACCCTTCTCCGGAAAATGGCACCGTTGATGCAACAGTGCTGCAGTATCAAAATCAGAAACTTGTCCAGCAGTTAGATGTCCAGAAACAGGAGTTACATGATCTTGAAGATAAAATTAAAGAATTAAGACAGGAGCAAACTTCTTACGATGACTTTTTGATCAAAATTAACCAACTATGGAGTCA...

Protein

Download Protein FASTA

881 aa · TkA01G174100|TK1151|PROTEIN

METSDSDEPEKKRPHLNNSDMARHPNPSPENGTVDATVLQYQNQKLVQQLDVQKQELHDLEDKIKELRQEQTSYDDFLIKINQLWSQLDDDLILLGSRAGTGQSALEALQHADSSRGSIPSCPAEDIFICRLLQSDSIGKNGSEEERIIYIKEALALRHSSTSQLMKLIEDTIQVLMVKIETIDQSFHEKDKSSEEDAIIQLNKIDELMKEEVKHLQIVIEALHVKHKEYADMIQSYSLSHSTDQSEIKRVAGDLEDSMA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G174100
TK1151 IDTkA01G174100
OH-1004 IDLXL04_004310
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G174100
LocationChr01:44557592-44562625 (+)
DescriptionSimilar to HUB2: E3 ubiquitin-protein ligase BRE1-like 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
UniProt: Q9C895 E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2ZAC2 E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. No verified direct reference in this release
Os10g0565600 E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1.
Histone H2B Monoubiquitination Mediated by HISTONE MONOUBIQUITINATION1 and HISTONE MONOUBIQUITINATION2 Is Involved in Anther Development by Regulating Tapetum Degradation-Related Genes in Rice.2015 · DOI: 10.1104/pp.114.256578
Flowering-Related RING Protein 1 (FRRP1) Regulates Flowering Time and Yield Potential by Affecting Histone H2B Monoubiquitination in Rice (Oryza Sativa).2016 · DOI: 10.1371/journal.pone.0150458
Os04g0550400 E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1.
Histone H2B Monoubiquitination Mediated by HISTONE MONOUBIQUITINATION1 and HISTONE MONOUBIQUITINATION2 Is Involved in Anther Development by Regulating Tapetum Degradation-Related Genes in Rice.2015 · DOI: 10.1104/pp.114.256578
UniProt: A2XW69 E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004310 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006325 chromatin organization Biological Process
GO:0006513 protein monoubiquitination Biological Process
GO:0009908 flower development Biological Process
GO:0009965 leaf morphogenesis Biological Process
GO:0010162 seed dormancy process Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0010389 regulation of G2/M transition of mitotic cell cycle Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0045087 innate immune response Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0051301 cell division Biological Process
GO:0051781 positive regulation of cell division Biological Process
KEGG gene cross-reference
ath:AT1G55250
ath:AT2G44950
dosa:Os04g0550400
dosa:Os10g0565600
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.812
Rank 1 · TkA01G174100 · TK1151
Cytoplasm0.223
Rank 2 · TkA01G174100 · TK1151
Golgi apparatus0.023
Rank 3 · TkA01G174100 · TK1151
Mitochondrion0.022
Rank 4 · TkA01G174100 · TK1151
Cell membrane0.021
Rank 5 · TkA01G174100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29075NOCA1_mid36-74 aa
PF24161CCDC3939-90 aa
PF07558Shugoshin_N42-72 aa
PF07888CALCOCO144-71 aa
PF27578ODF2_N48-71 aa
PF26187Ig_NPHP4_4th158-209 aa
PF29075NOCA1_mid172-276 aa
PF27578ODF2_N250-349 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G174100PF29075NOCA1_mid36740.03814.6
TkA01G174100PF24161CCDC3939905.7e-0521.9
TkA01G174100PF07558Shugoshin_N42722.48.7
TkA01G174100PF07888CALCOCO144711.98.0
TkA01G174100PF27578ODF2_N48710.003718.2
TkA01G174100PF26187Ig_NPHP4_4th1582090.1113.4
TkA01G174100PF29075NOCA1_mid1722760.03814.6
TkA01G174100PF27578ODF2_N2503490.003718.2
TkA01G174100PF07888CALCOCO13264101.98.0
TkA01G174100PF29075NOCA1_mid3274270.03814.6
TkA01G174100PF27578ODF2_N3894530.003718.2
TkA01G174100PF29075NOCA1_mid4165510.03814.6
TkA01G174100PF07558Shugoshin_N4224352.48.7
TkA01G174100PF07888CALCOCO14237181.98.0
TkA01G174100PF27578ODF2_N4665370.003718.2
TkA01G174100PF07558Shugoshin_N5075352.48.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C895Arabidopsis thalianasp|Q9C895|BRE1B_ARATH E3 ubiquitin-protein ligase BRE1-like 252.900%Swiss-ProtHigh
A2ZAC2Oryza sativa subsp. indicasp|A2ZAC2|BRE1B_ORYSI E3 ubiquitin-protein ligase BRE1-like 250.800%Swiss-ProtHigh
Q336R3Oryza sativa subsp. japonicasp|Q336R3|BRE1B_ORYSJ E3 ubiquitin-protein ligase BRE1-like 250.800%Swiss-ProtHigh
Q7XU27Oryza sativa subsp. japonicasp|Q7XU27|BRE1A_ORYSJ E3 ubiquitin-protein ligase BRE1-like 130.100%Swiss-ProtMedium
A2XW69Oryza sativa subsp. indicasp|A2XW69|BRE1A_ORYSI E3 ubiquitin-protein ligase BRE1-like 130.000%Swiss-ProtMedium

JBrowse

View in Genome Browser