TkA01G170090 | RubberDandelionOmics

Gene overview

TkA01G170090

Reference: TK1151 Chr: Chr01 Coordinates: 43576422-43578674 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1697 bp · TkA01G170090|TK1151|cDNA

TTCTAGTCGACCATCGAATGATCAAATATCTCCAACGGTCAGGAGATATCTAGTGGCCTTGTTGTAGATCGAGAATGTGAGCTTACTTTAAGGCTTCGGGACAAACAGTCAACAACACCACTTTGAATCATGGACATTCCACAACACCCATCTCTCCCTTTCCTCCTTGTACTATCGCTGCTACCCGCCGCCGCATACTCCATCGGCGTCAACTACGGAACCCTCGGCGACAACCTTCCACCGCCTTCTGAAGTCGCCCA...

CDS

Download CDS FASTA

1302 bp · TkA01G170090|TK1151|CDS

ATGGACATTCCACAACACCCATCTCTCCCTTTCCTCCTTGTACTATCGCTGCTACCCGCCGCCGCATACTCCATCGGCGTCAACTACGGAACCCTCGGCGACAACCTTCCACCGCCTTCTGAAGTCGCCCACTTCCTCAAAACCCGCACCACCATCGACAGCATCAGGATCTTCGACGTCAACACCACCATCATCAAAGCTTTCGCCGGAACAGGCATCCTCGTCTCCGTGACCGTCCCCAACGGCGATATCCCTTCCCT...

Protein

Download Protein FASTA

433 aa · TkA01G170090|TK1151|PROTEIN

MDIPQHPSLPFLLVLSLLPAAAYSIGVNYGTLGDNLPPPSEVAHFLKTRTTIDSIRIFDVNTTIIKAFAGTGILVSVTVPNGDIPSLTDARNARRWIDANIKPFYPATKIHYICMGTEVLHWGPQPLIDSLVPAMQVLHAALVKEGFDEIKISTPHSLGILLQSVPPSSASFRPGWDVGTLQPMLKFLKETKSGFMVNPYTYFGWSPANANFCLFKPNAGLFDKATGLTYTNQFDQLMDAVHVSMKKLGYPDVEVVVAET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G170090`
TK1151 ID	TkA01G170090
OH-1004 ID	LXL04_012359
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G170090

Location Chr01:43576422-43578674 (+)

Description Similar to GLC1: Glucan endo-1,3-beta-glucosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34480`	Glucan endo-1,3-beta-glucosidase 7.	No verified direct reference in this release
`At4g29360`	Glucan endo-1,3-beta-glucosidase 12.	No verified direct reference in this release
`At5g42100`	Plasmodesmal-associated membrane beta-1,3-glucanase involved in plasmodesmal callose degradation and functions in the gating of plasmodesmata.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012359 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006076 (1->3)-beta-D-glucan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0034407 cell wall (1->3)-beta-D-glucan metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0140547 acquisition of seed longevity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G32860

ath:AT2G27500

ath:AT4G34480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.554

Rank 1 · TkA01G170090 · TK1151

Extracellular0.251

Rank 2 · TkA01G170090 · TK1151

Endoplasmic reticulum0.103

Rank 3 · TkA01G170090 · TK1151

Cytoplasm0.075

Rank 4 · TkA01G170090 · TK1151

Lysosome / Vacuole0.034

Rank 5 · TkA01G170090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332Glyco_hydro_1725-338 aa

PF29664BtgE-BtgC_glyc-hydro50-156 aa

PF12655CDIF630_02480-like84-102 aa

PF29664BtgE-BtgC_glyc-hydro249-319 aa

PF27998ArabinogalactanP342-431 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G170090	`PF00332`	Glyco_hydro_17	25	338	3.4e-72	244.4
TkA01G170090	`PF29664`	BtgE-BtgC_glyc-hydro	50	156	4.3e-07	30.1
TkA01G170090	`PF12655`	CDIF630_02480-like	84	102	0.23	12.2
TkA01G170090	`PF29664`	BtgE-BtgC_glyc-hydro	249	319	4.3e-07	30.1
TkA01G170090	`PF27998`	ArabinogalactanP	342	431	0.099	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M069`	Arabidopsis thaliana	sp\|Q9M069\|E137_ARATH Glucan endo-1,3-beta-glucosidase 7	47.800%	Swiss-Prot	Medium
`Q8VYE5`	Arabidopsis thaliana	sp\|Q8VYE5\|E1312_ARATH Glucan endo-1,3-beta-glucosidase 12	39.800%	Swiss-Prot	Medium
`Q9FHX5`	Arabidopsis thaliana	sp\|Q9FHX5\|E1310_ARATH Glucan endo-1,3-beta-glucosidase 10	39.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card