LXL04_012359 | RubberDandelionOmics

Gene overview

LXL04_012359

Reference: OH-1004 Chr: Chr03 Coordinates: 11018046-11019902 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1302 bp · LXL04_012359|LXL04_012359|OH1004|cDNA

ATGGACATTCCACAACACCCATCTCTCCCTTTCCTCCTTGTACTATCGCTGCTACCCGCCGCCGCATACTCCATCGGCGTCAACTACGGAACCCTCGGCGACAACCTTCCACCGCCTTCTGAAGTAGCTCACTTCCTCAAAACCCGCACCACCATCGACAGCATCAGGATCTTCGACGTCAACACCACCATCATCAAAGCTTTCGCCGGAACAGGCATCCTCGTCTCCGTCACCGTCCCCAACGGCGATATCCCTTCCCT...

CDS

Download CDS FASTA

1302 bp · LXL04_012359|LXL04_012359|OH1004|CDS

ATGGACATTCCACAACACCCATCTCTCCCTTTCCTCCTTGTACTATCGCTGCTACCCGCCGCCGCATACTCCATCGGCGTCAACTACGGAACCCTCGGCGACAACCTTCCACCGCCTTCTGAAGTAGCTCACTTCCTCAAAACCCGCACCACCATCGACAGCATCAGGATCTTCGACGTCAACACCACCATCATCAAAGCTTTCGCCGGAACAGGCATCCTCGTCTCCGTCACCGTCCCCAACGGCGATATCCCTTCCCT...

Protein

Download Protein FASTA

433 aa · LXL04_012359|LXL04_012359|OH1004|PROTEIN

MDIPQHPSLPFLLVLSLLPAAAYSIGVNYGTLGDNLPPPSEVAHFLKTRTTIDSIRIFDVNTTIIKAFAGTGILVSVTVPNGDIPSLTDARNARRWIDANIKPFYPATKIHYICMGTEVLHWGPQPLIDSLVPAMQVLHAALVKEGFDEIKISTPHSLGILLQSVPPSSASFRPGWDVGTLQPMLKFLKETKSGFMVNPYTYFGWSPANANFCLFKPNAGLFDKATGLTYTNQFDQLMDAVHVSMKKLGYPDVEVVVAET...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012359`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012359

Location Chr03:11018046-11019902 (-)

Description Similar to GLC1: Glucan endo-1,3-beta-glucosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34480`	Glucan endo-1,3-beta-glucosidase 7.	No verified direct reference in this release
`At1g32860`	Glucan endo-1,3-beta-glucosidase 11.	No verified direct reference in this release
`At2g27500`	Glucan endo-1,3-beta-glucosidase 14.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012359 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006076 (1->3)-beta-D-glucan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0034407 cell wall (1->3)-beta-D-glucan metabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0140547 acquisition of seed longevity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

KEGG gene cross-reference

ath:AT1G32860

ath:AT2G27500

ath:AT4G34480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.547

Rank 1 · LXL04_012359 · OH-1004

Extracellular0.256

Rank 2 · LXL04_012359 · OH-1004

Endoplasmic reticulum0.103

Rank 3 · LXL04_012359 · OH-1004

Cytoplasm0.075

Rank 4 · LXL04_012359 · OH-1004

Golgi apparatus0.034

Rank 5 · LXL04_012359 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332.25Glyco_hydro_1725-338 aa

PF29664.1BtgE-BtgC_glyc-hydro249-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012359	`PF00332.25`	Glyco_hydro_17	25	338	3.4e-72	244.4
LXL04_012359	`PF29664.1`	BtgE-BtgC_glyc-hydro	249	319	4.3e-07	30.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M069`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 7	47.522%	Swiss-Prot	moderate database homology
`Q8L868`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 11	42.105%	Swiss-Prot	moderate database homology
`Q9ZQG9`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 14	37.267%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card