TkA01G169230 | RubberDandelionOmics

Gene overview

TkA01G169230

Reference: TK1151 Chr: Chr01 Coordinates: 43392040-43392513 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA01G169230|TK1151|cDNA

CTTCTACATCACTGGCAAAAATATTTCACTGGCGTGTCCTCTATCTTCTCAACCTCCGATCTCACTGGCAACCGATCTTCCATAGCCAGAGCTCCTCCTCTACCCGGGTTTTCTCGACCTGTCCGGTCGACAGTTTCCCTTTCACACTCCCTCCGAGTCTACGCACCAGGTGTGGTCCATCTGAACACTATCCGGTGTCGTGTGAACCGCTCCGGAGGTGCGTATTCCCCTCTTAACTTCGGTTCAAATTACAGCGATCG...

CDS

Download CDS FASTA

411 bp · TkA01G169230|TK1151|CDS

CTTCTACATCACTGGCAAAAATATTTCACTGGCGTGTCCTCTATCTTCTCAACCTCCGATCTCACTGGCAACCGATCTTCCATAGCCAGAGCTCCTCCTCTACCCGGGTTTTCTCGACCTGTCCGGTCGACAGTTTCCCTTTCACACTCCCTCCGAGTCTACGCACCAGGTGTGGTCCATCTGAACACTATCCGGTGTCGTGTGAACCGCTCCGGAGGTGCGTATTCCCCTCTTAACTTCGGTTCAAATTACAGCGATCG...

Protein

Download Protein FASTA

136 aa · TkA01G169230|TK1151|PROTEIN

LLHHWQKYFTGVSSIFSTSDLTGNRSSIARAPPLPGFSRPVRSTVSLSHSLRVYAPGVVHLNTIRCRVNRSGGAYSPLNFGSNYSDRPPMEMGPLFTGCDYEHWLIVMDKPGGEGATQQQMIDCYVETLAKVLGSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G169230`
TK1151 ID	TkA01G169230
OH-1004 ID	LXL04_029329
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	54.300
Protein coverage (%)	TK1151 50.735 / OH-1004 25.461 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G169230

Location Chr01:43392040-43392513 (-)

Description Similar to MORF3: Multiple organellar RNA editing factor 3, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35240`	Involved in organellar RNA editing.	No verified direct reference in this release
`At2g33430`	Involved in plastid rRNA processing and consequently in translation and early chloroplast differentiation.	The Arabidopsis nuclear DAL gene encodes a chloroplast protein which is required for the maturation of the plastid ribosomal RNAs and is essential for chloroplast differentiation.2003 · DOI: 10.1023/a:1022557825768
`At1g32580`	Involved in organellar RNA editing.	No verified direct reference in this release
`At3g06790`	Involved in organellar RNA editing.	No verified direct reference in this release
`At3g15000`	Involved in organellar RNA editing.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029329 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:1900864 mitochondrial RNA modification Biological Process

GO:1900865 chloroplast RNA modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G11430

ath:AT1G32580

ath:AT2G35240

ath:AT3G06790

ath:AT3G15000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.390

Rank 1 · TkA01G169230 · TK1151

Cytoplasm0.371

Rank 2 · TkA01G169230 · TK1151

Mitochondrion0.153

Rank 3 · TkA01G169230 · TK1151

Cell membrane0.108

Rank 4 · TkA01G169230 · TK1151

Endoplasmic reticulum0.078

Rank 5 · TkA01G169230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21864MORF_dom101-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G169230	`PF21864`	MORF_dom	101	135	4.1e-11	43.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82169`	Arabidopsis thaliana	sp\|O82169\|MORF6_ARATH Multiple organellar RNA editing factor 6, mitochondrial	56.700%	Swiss-Prot	High
`O22793`	Arabidopsis thaliana	sp\|O22793\|MORF2_ARATH Multiple organellar RNA editing factor 2, chloroplastic	59.700%	Swiss-Prot	High
`Q9C7Y2`	Arabidopsis thaliana	sp\|Q9C7Y2\|MORF5_ARATH Multiple organellar RNA editing factor 5, chloroplastic/mitochondrial	62.100%	Swiss-Prot	High
`Q84JZ6`	Arabidopsis thaliana	sp\|Q84JZ6\|MORF3_ARATH Multiple organellar RNA editing factor 3, mitochondrial	44.700%	Swiss-Prot	Medium
`Q9LKA5`	Arabidopsis thaliana	sp\|Q9LKA5\|MORF8_ARATH Multiple organellar RNA editing factor 8, chloroplastic/mitochondrial	36.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card