TkA01G168030 | RubberDandelionOmics

Gene overview

TkA01G168030

Reference: TK1151 Chr: Chr01 Coordinates: 43058628-43059492 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkA01G168030|TK1151|cDNA

ATGGAGGTGCCAAGAAGGTCATCATCTTTGCCCCTAGCAAGGATGCACCCATGTTTGTTGTGGGTATGGGCGTATCTAGCATATAAGAAGGGTTCGCCACTGGTTGTGGGTATCAACGAGAAGGAACACAAACCCGAATTCGACATTGTTTCAAACGCTAGTTGCACAACCAACTGCCTTGCTCCTTTGGCCAATGAAATCACCGACATATTTAGCATTATTGAGGGACTCATGACACCTGTCCACTCCATCACAGCCAC...

CDS

Download CDS FASTA

519 bp · TkA01G168030|TK1151|CDS

ATGGAGGTGCCAAGAAGGTCATCATCTTTGCCCCTAGCAAGGATGCACCCATGTTTGTTGTGGGTATGGGCGTATCTAGCATATAAGAAGGGTTCGCCACTGGTTGTGGGTATCAACGAGAAGGAACACAAACCCGAATTCGACATTGTTTCAAACGCTAGTTGCACAACCAACTGCCTTGCTCCTTTGGCCAATGAAATCACCGACATATTTAGCATTATTGAGGGACTCATGACACCTGTCCACTCCATCACAGCCAC...

Protein

Download Protein FASTA

172 aa · TkA01G168030|TK1151|PROTEIN

MEVPRRSSSLPLARMHPCLLWVWAYLAYKKGSPLVVGINEKEHKPEFDIVSNASCTTNCLAPLANEITDIFSIIEGLMTPVHSITATQKTIDGPSMKDWRSGRAASFNIISSCQVVDLTVRLEKKETYEQIKAAIKEESEGKMKGILKSMLCQQTLLVTASQASLMPRLELL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G168030`
TK1151 ID	TkA01G168030
OH-1004 ID	LXL04_020686
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.800
Protein coverage (%)	TK1151 70.349 / OH-1004 32.272 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G168030

Location Chr01:43058628-43059492 (+)

Description Similar to GAPC2: Glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0486600`	Key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020686 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006006 glucose metabolic process Biological Process

GO:0006094 gluconeogenesis Biological Process

GO:0006096 glycolytic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010154 fruit development Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0048316 seed development Biological Process

GO:0051775 response to redox state Biological Process

KEGG gene cross-reference

ath:AT1G13440

ath:AT3G04120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.368

Rank 1 · TkA01G168030 · TK1151

Nucleus0.322

Rank 2 · TkA01G168030 · TK1151

Mitochondrion0.239

Rank 3 · TkA01G168030 · TK1151

Cell membrane0.090

Rank 4 · TkA01G168030 · TK1151

Endoplasmic reticulum0.062

Rank 5 · TkA01G168030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02800Gp_dh_C54-110 aa

PF07687M20_dimer82-140 aa

PF02800Gp_dh_C113-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G168030	`PF02800`	Gp_dh_C	54	110	9.5e-27	94.6
TkA01G168030	`PF07687`	M20_dimer	82	140	0.16	12.7
TkA01G168030	`PF02800`	Gp_dh_C	113	148	9.5e-27	94.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7FAH2`	Oryza sativa subsp. japonica	sp\|Q7FAH2\|G3PC2_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic	61.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card