Gene Card
Gene overview
cDNA / CDS / Protein Sequences
906 bp · TkA01G162130|TK1151|cDNA
ATGTCTCCATATTCTGCATTTATCAACTCTTCTTCATCTATAGAAGCCCTTTCTCATGGAAACAACAATCTCAACTCATCCATAATTTCAGGCACAATTCCTGTGGAGTTTTGGGACATATGGCCATTTCAATTAAGATATTTGAATCTCTCTTCCAACAACATCAGTGGGAATGTACCAGATTTATTATCAAATTTTGGGACCAATTCAGTGATAGATTTGAGTTCCAACAACTTCCATGGCCCAATGCCACTTGTACC...
906 bp · TkA01G162130|TK1151|CDS
ATGTCTCCATATTCTGCATTTATCAACTCTTCTTCATCTATAGAAGCCCTTTCTCATGGAAACAACAATCTCAACTCATCCATAATTTCAGGCACAATTCCTGTGGAGTTTTGGGACATATGGCCATTTCAATTAAGATATTTGAATCTCTCTTCCAACAACATCAGTGGGAATGTACCAGATTTATTATCAAATTTTGGGACCAATTCAGTGATAGATTTGAGTTCCAACAACTTCCATGGCCCAATGCCACTTGTACC...
Protein
Download Protein FASTA301 aa · TkA01G162130|TK1151|PROTEIN
MSPYSAFINSSSSIEALSHGNNNLNSSIISGTIPVEFWDIWPFQLRYLNLSSNNISGNVPDLLSNFGTNSVIDLSSNNFHGPMPLVPSTLVSLDLSRNKFQGGISFLCQLVDGFLSFLDLSHNSLTEEHPDCLWHFKELKVLNIGDNNLSGRLPPSIGSLIKLDVLYLYNNKLYGEFPSLLKDCTKLIFLDLGANKFFGNLPVWIGENMRGLYALSLRSNNFFGVIPLKLCQLSNLQILDLSMNNLHGTIPSCLKNLTAM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G162130 |
|---|---|
| TK1151 ID | TkA01G162130 |
| OH-1004 ID | LXL04_004351 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 97.300 |
| Protein coverage (%) | TK1151 87.708 / OH-1004 33.166Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G162130 |
|---|---|
| Location | Chr01:41439826-41441879 (+) |
| Description | Similar to EIX1: Receptor-like protein EIX1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process GO:0007165 signal transduction Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0010073 meristem maintenance Biological Process GO:0050832 defense response to fungus Biological Process GO:0090696 post-embryonic plant organ development Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0004672 protein kinase activity Molecular Function GO:0005524 ATP binding Molecular Function |
| KEGG gene cross-reference | ath:AT1G71400 dosa:Os04g0576900 osa:4336741 sly:543900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13855LRR_815-25 aaPF12799LRR_421-24 aaPF00560LRR_123-38 aaPF24141LRR_ComC25-105 aaPF23598LRR_1443-79 aaPF00560LRR_144-66 aaPF12799LRR_444-61 aaPF25013LRR_Zer-144-58 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G162130 | PF13855 | LRR_8 | 15 | 25 | 7.9e-14 | 51.9 |
| TkA01G162130 | PF12799 | LRR_4 | 21 | 24 | 7.8e-12 | 45.7 |
| TkA01G162130 | PF00560 | LRR_1 | 23 | 38 | 7.6e-24 | 79.4 |
| TkA01G162130 | PF24141 | LRR_ComC | 25 | 105 | 0.00021 | 21.8 |
| TkA01G162130 | PF23598 | LRR_14 | 43 | 79 | 5.8e-10 | 39.2 |
| TkA01G162130 | PF00560 | LRR_1 | 44 | 66 | 7.6e-24 | 79.4 |
| TkA01G162130 | PF12799 | LRR_4 | 44 | 61 | 7.8e-12 | 45.7 |
| TkA01G162130 | PF25013 | LRR_Zer-1 | 44 | 58 | 0.0034 | 18.3 |
| TkA01G162130 | PF24048 | LRR_NXF1-5 | 44 | 56 | 0.13 | 12.7 |
| TkA01G162130 | PF13855 | LRR_8 | 45 | 79 | 7.9e-14 | 51.9 |
| TkA01G162130 | PF13516 | LRR_6 | 45 | 57 | 7.3e-07 | 29.5 |
| TkA01G162130 | PF29265 | LRR_CARMIL | 45 | 91 | 2.5 | 7.4 |
| TkA01G162130 | PF29460 | LRR_NXF2 | 46 | 79 | 0.21 | 12.1 |
| TkA01G162130 | PF00560 | LRR_1 | 71 | 84 | 7.6e-24 | 79.4 |
| TkA01G162130 | PF13516 | LRR_6 | 72 | 80 | 7.3e-07 | 29.5 |
| TkA01G162130 | PF29265 | LRR_CARMIL | 85 | 151 | 2.5 | 7.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.