Gene Card
Gene overview
cDNA / CDS / Protein Sequences
630 bp · TkA01G156020|TK1151|cDNA
ATGGGCACTCTCATCTGGCTGATCGGAGTTGCGATAGTACTGACCGCCGGTGTGACAGTAAACGCATGTCCGCCGTCTGATAGGGCGGCGTTGCTGGCCTTCAAAGCAGGCTTACATGAGCCATACTTGGGCATTTTCAAATCATGGACGGGAAACGATTGTTGTAGCAAATGGTACGGTGTTACTTGCGACCCGGCTACAAAACGGGTCGCCGATATAAACCTCCGGGGAGAGTCTGAAGATCCGCTGTTCCAGAAAGC...
630 bp · TkA01G156020|TK1151|CDS
ATGGGCACTCTCATCTGGCTGATCGGAGTTGCGATAGTACTGACCGCCGGTGTGACAGTAAACGCATGTCCGCCGTCTGATAGGGCGGCGTTGCTGGCCTTCAAAGCAGGCTTACATGAGCCATACTTGGGCATTTTCAAATCATGGACGGGAAACGATTGTTGTAGCAAATGGTACGGTGTTACTTGCGACCCGGCTACAAAACGGGTCGCCGATATAAACCTCCGGGGAGAGTCTGAAGATCCGCTGTTCCAGAAAGC...
Protein
Download Protein FASTA209 aa · TkA01G156020|TK1151|PROTEIN
MGTLIWLIGVAIVLTAGVTVNACPPSDRAALLAFKAGLHEPYLGIFKSWTGNDCCSKWYGVTCDPATKRVADINLRGESEDPLFQKARRTGYMTGTISPAICKLDRLSSVIIADWKGISGTIPSCISSLSFLRILDLIGNKISGEIPFDIGKLRHLTVLNVADNKITGRIPRSLADLSSLKHLDLRNNFVHLPAIRSRSLVEPFLRTDP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G156020 |
|---|---|
| TK1151 ID | TkA01G156020 |
| OH-1004 ID | LXL04_004409 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 67.943 / OH-1004 38.904Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G156020 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:39868646-39869376 (-) | |||||||||
| Description | Similar to DRT100: DNA damage-repair/toleration protein DRT100 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001558 regulation of cell growth Biological Process GO:0006281 DNA repair Biological Process GO:0007165 signal transduction Biological Process GO:0010286 heat acclimation Biological Process GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0033612 receptor serine/threonine kinase binding Molecular Function GO:0106310 protein serine kinase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G12610 dosa:Os06g0203800 osa:4340427 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08263LRRNT_225-64 aaPF00560LRR_194-104 aaPF25019LRR_R13L1-DRL2198-162 aaPF25013LRR_Zer-1103-138 aaPF08263LRRNT_2114-118 aaPF00560LRR_1118-129 aaPF13855LRR_8118-143 aaPF12799LRR_4119-142 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G156020 | PF08263 | LRRNT_2 | 25 | 64 | 7.5e-13 | 49.3 |
| TkA01G156020 | PF00560 | LRR_1 | 94 | 104 | 7e-11 | 40.8 |
| TkA01G156020 | PF25019 | LRR_R13L1-DRL21 | 98 | 162 | 0.15 | 12.7 |
| TkA01G156020 | PF25013 | LRR_Zer-1 | 103 | 138 | 0.1 | 13.5 |
| TkA01G156020 | PF08263 | LRRNT_2 | 114 | 118 | 7.5e-13 | 49.3 |
| TkA01G156020 | PF00560 | LRR_1 | 118 | 129 | 7e-11 | 40.8 |
| TkA01G156020 | PF13855 | LRR_8 | 118 | 143 | 6.4e-09 | 36.2 |
| TkA01G156020 | PF12799 | LRR_4 | 119 | 142 | 5.7e-10 | 39.8 |
| TkA01G156020 | PF23598 | LRR_14 | 121 | 187 | 5.8e-09 | 35.9 |
| TkA01G156020 | PF25013 | LRR_Zer-1 | 126 | 186 | 0.1 | 13.5 |
| TkA01G156020 | PF13516 | LRR_6 | 130 | 145 | 3e-06 | 27.6 |
| TkA01G156020 | PF00560 | LRR_1 | 132 | 153 | 7e-11 | 40.8 |
| TkA01G156020 | PF12799 | LRR_4 | 132 | 167 | 5.7e-10 | 39.8 |
| TkA01G156020 | PF25019 | LRR_R13L1-DRL21 | 132 | 187 | 0.15 | 12.7 |
| TkA01G156020 | PF13855 | LRR_8 | 152 | 188 | 6.4e-09 | 36.2 |
| TkA01G156020 | PF13516 | LRR_6 | 153 | 168 | 3e-06 | 27.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.