LXL04_004409 | RubberDandelionOmics

Gene overview

LXL04_004409

Reference: OH-1004 Chr: Chr01 Coordinates: 134825561-134826658 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1098 bp · LXL04_004409|LXL04_004409|OH1004|cDNA

ATGGGCACTCTCATCTGGCTGATCGGAGTTGCGATAGTACTGACCGCCGGTGTGACAGTAAACGCATGTCCGCCGTCTGATAGGGCGGCGTTGCTGGCCTTCAAAGCAGGCTTACATGAGCCATACTTGGGCATTTTCAAATCATGGACGGGAAACGATTGTTGTAGCAAATGGTACGGTGTTACTTGCGACCCGGCTACAAAACGGGTCGCCGATATAAACCTCCGGGGAGAGTCTGAAGATCCGCTGTTCCAGAAAGC...

CDS

Download CDS FASTA

1098 bp · LXL04_004409|LXL04_004409|OH1004|CDS

ATGGGCACTCTCATCTGGCTGATCGGAGTTGCGATAGTACTGACCGCCGGTGTGACAGTAAACGCATGTCCGCCGTCTGATAGGGCGGCGTTGCTGGCCTTCAAAGCAGGCTTACATGAGCCATACTTGGGCATTTTCAAATCATGGACGGGAAACGATTGTTGTAGCAAATGGTACGGTGTTACTTGCGACCCGGCTACAAAACGGGTCGCCGATATAAACCTCCGGGGAGAGTCTGAAGATCCGCTGTTCCAGAAAGC...

Protein

Download Protein FASTA

365 aa · LXL04_004409|LXL04_004409|OH1004|PROTEIN

MGTLIWLIGVAIVLTAGVTVNACPPSDRAALLAFKAGLHEPYLGIFKSWTGNDCCSKWYGVTCDPATKRVADINLRGESEDPLFQKARRTGYMTGTISPAICKLDRLSSVIIADWKGISGTIPSCISSLSFLRILDLIGNKISGEIPFDIGKLRHLTVLNVADNKITGRIPRSLADLSSLKHLDLRNNLISGTIPRNIGKLRMLSRALLSGNRIYGPVPETISYIYRLSDLDLSLNRFSGPIPESLGKMSVLGTLNLDGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004409`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004409

Location Chr01:134825561-134826658 (+)

Description Similar to DRT100: DNA damage-repair/toleration protein DRT100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12610`	This protein is able to complement bacterial recA mutations, but its native function in the plant is not known.	No verified direct reference in this release
`At3g05660`	Receptor-like protein 33.	No verified direct reference in this release
`At3g12145`	Promotes flowering transition in long days (LD).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0203800`	Receptor kinase involved in the regulation of thermotolerance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004409 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0006281 DNA repair Biological Process

GO:0007165 signal transduction Biological Process

GO:0010286 heat acclimation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0033612 receptor serine/threonine kinase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G12610

dosa:Os06g0203800

osa:4340427

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.435

Rank 1 · LXL04_004409 · OH-1004

Cell membrane0.288

Rank 2 · LXL04_004409 · OH-1004

Endoplasmic reticulum0.122

Rank 3 · LXL04_004409 · OH-1004

Cytoplasm0.068

Rank 4 · LXL04_004409 · OH-1004

Plastid0.035

Rank 5 · LXL04_004409 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_225-64 aa

PF23598.2LRR_14121-186 aa

PF12799.14LRR_4132-167 aa

PF13855.13LRR_8154-214 aa

PF12799.14LRR_4155-191 aa

PF23598.2LRR_14173-257 aa

PF13855.13LRR_8274-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004409	`PF08263.18`	LRRNT_2	25	64	2.3e-12	47.7
LXL04_004409	`PF23598.2`	LRR_14	121	186	3.4e-13	49.8
LXL04_004409	`PF12799.14`	LRR_4	132	167	1.5e-09	38.5
LXL04_004409	`PF13855.13`	LRR_8	154	214	1.1e-20	73.9
LXL04_004409	`PF12799.14`	LRR_4	155	191	1.5e-09	38.5
LXL04_004409	`PF23598.2`	LRR_14	173	257	3.4e-13	49.8
LXL04_004409	`PF13855.13`	LRR_8	274	333	1.1e-20	73.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q00874`	Arabidopsis thaliana	DNA damage-repair/toleration protein DRT100	59.357%	Swiss-Prot	strong database homology
`F4J8G2`	Arabidopsis thaliana	Receptor-like protein 33	34.218%	Swiss-Prot	moderate database homology
`Q9LH52`	Arabidopsis thaliana	Leucine-rich repeat protein FLOR 1	32.081%	Swiss-Prot	moderate database homology
`Q69SP5`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase ER1	35.398%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card