Gene Card
Gene overview
cDNA / CDS / Protein Sequences
696 bp · TkA01G147600|TK1151|cDNA
TATTGGTGCCGAAAAAGGTCAATGTGTTTATGTGGGAAAGGCTGCCCGTCACAGATAATTGATTACATTACAGACAAGGCACTTGAGTTCACTTACAGTTACTGGGATGGTGCCGTTCACAGAAGAGCCATGCAGGACAAGCACATATTTCCTACTTTGATGTACATGAAGATTTTCCAACAATTGCTGATGCAGCCACAGAGAAAGATGAGGTACACTTACCCCCAATTGTATGAGAAGAACAAGCACATATTTCCTGC...
366 bp · TkA01G147600|TK1151|CDS
ATGTGTTTATGTGGGAAAGGCTGCCCGTCACAGATAATTGATTACATTACAGACAAGGCACTTGAGTTCACTTACAGTTACTGGGATGGTGCCGTTCACAGAAGAGCCATGCAGGACAAGCACATATTTCCTACTTTGATGTACATGAAGATTTTCCAACAATTGCTGATGCAGCCACAGAGAAAGATGAGGTACACTTACCCCCAATTGTATGAGAAGAACAAGCACATATTTCCTGCTTCAAGATGGGAGGTACACTT...
Protein
Download Protein FASTA121 aa · TkA01G147600|TK1151|PROTEIN
MCLCGKGCPSQIIDYITDKALEFTYSYWDGAVHRRAMQDKHIFPTLMYMKIFQQLLMQPQRKMRYTYPQLYEKNKHIFPASRWEVHLPPNFIYYLFFMIDRLSHTDIYCLFLNFWQTNVHI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G147600 |
|---|---|
| TK1151 ID | TkA01G147600 |
| OH-1004 ID | LXL04_025339 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 27.500 |
| Protein coverage (%) | TK1151 61.983 / OH-1004 20.659Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G147600 |
|---|---|
| Location | Chr01:37353473-37354237 (+) |
| Description | Similar to XCT: Protein XAP5 CIRCADIAN TIMEKEEPER |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006325 chromatin organization Biological Process GO:0006397 mRNA processing Biological Process GO:0007283 spermatogenesis Biological Process GO:0008380 RNA splicing Biological Process GO:0009637 response to blue light Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:0010099 regulation of photomorphogenesis Biological Process GO:0010114 response to red light Biological Process GO:0035196 miRNA processing Biological Process GO:0042752 regulation of circadian rhythm Biological Process GO:0043484 regulation of RNA splicing Biological Process GO:0048511 rhythmic process Biological Process |
| KEGG gene cross-reference | ath:AT2G21150 dosa:Os09g0535300 hsa:9130 mmu:108161 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04921XAP521-34 aaPF31033YehL_C25-47 aaPF04921XAP538-48 aaPF04921XAP569-88 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G147600 | PF04921 | XAP5 | 21 | 34 | 4.9e-07 | 30.9 |
| TkA01G147600 | PF31033 | YehL_C | 25 | 47 | 0.052 | 14.2 |
| TkA01G147600 | PF04921 | XAP5 | 38 | 48 | 4.9e-07 | 30.9 |
| TkA01G147600 | PF04921 | XAP5 | 69 | 88 | 4.9e-07 | 30.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.