LXL04_025339 | RubberDandelionOmics

Gene overview

LXL04_025339

Reference: OH-1004 Chr: Chr05 Coordinates: 110054529-110061377 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2007 bp · LXL04_025339|LXL04_025339|OH1004|cDNA

ATGTCGGGCATGGGGGACGGGTACGTGGGTACCGCCCAAGACGCTGTAAGGATCCGAAGGCTCGAGAAACAAAGAGAGGCGGAAAGGAAAAAGATCCAAGAGCTCAAAAGTAAGAACGCAAAAGGCCAATCCGGTCTTCTCCAATTCGGCTCCGGAACCTCCGAAATTCTTGAAACTGCCTTCAAGAAGGAAACAGTTGGGCTTGTCACAAGGGAGCAGTATGTTGAAAAGAGGGTTAACATTCGAACCAaaattgaaga...

CDS

Download CDS FASTA

2007 bp · LXL04_025339|LXL04_025339|OH1004|CDS

ATGTCGGGCATGGGGGACGGGTACGTGGGTACCGCCCAAGACGCTGTAAGGATCCGAAGGCTCGAGAAACAAAGAGAGGCGGAAAGGAAAAAGATCCAAGAGCTCAAAAGTAAGAACGCAAAAGGCCAATCCGGTCTTCTCCAATTCGGCTCCGGAACCTCCGAAATTCTTGAAACTGCCTTCAAGAAGGAAACAGTTGGGCTTGTCACAAGGGAGCAGTATGTTGAAAAGAGGGTTAACATTCGAACCAAAATTGAAGA...

Protein

Download Protein FASTA

668 aa · LXL04_025339|LXL04_025339|OH1004|PROTEIN

MSGMGDGYVGTAQDAVRIRRLEKQREAERKKIQELKSKNAKGQSGLLQFGSGTSEILETAFKKETVGLVTREQYVEKRVNIRTKIEEEEKEKLQKLQQEEEELQLQKLKKRKVKANPKLSFSEDIENGEEEEEDDGEDKNKESNMFGRRGFGKDPTVETSFLPDSEREAEEQAERERLRKQWLREQEQIKNEALEITYSYWDGAGHRRVMQVRKGDTIGEFLRSVQQQLAPEFREIRTTSVENLLYVKEDLIIPHQHSFY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025339`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025339

Location Chr05:110054529-110061377 (-)

Description Similar to XCT: Protein XAP5 CIRCADIAN TIMEKEEPER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21150`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0535300`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release
`UniProt: B8BDW1`	Involved in light regulation of the circadian clock and photomorphogenesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025339 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009637 response to blue light Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

GO:0010114 response to red light Biological Process

GO:0035196 miRNA processing Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0048511 rhythmic process Biological Process

KEGG gene cross-reference

ath:AT2G21150

dosa:Os09g0535300

hsa:9130

mmu:108161

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.715

Rank 1 · LXL04_025339 · OH-1004

Nucleus0.216

Rank 2 · LXL04_025339 · OH-1004

Cytoplasm0.129

Rank 3 · LXL04_025339 · OH-1004

Golgi apparatus0.093

Rank 4 · LXL04_025339 · OH-1004

Cell membrane0.054

Rank 5 · LXL04_025339 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04921.21XAP5193-330 aa

PF03896.22TRAP_alpha482-638 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025339	`PF04921.21`	XAP5	193	330	3.9e-52	177.4
LXL04_025339	`PF03896.22`	TRAP_alpha	482	638	2e-08	34.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H110`	Arabidopsis thaliana	Protein XAP5 CIRCADIAN TIMEKEEPER	84.084%	Swiss-Prot	weak database homology
`Q69JZ7`	Oryza sativa subsp. japonica	Protein XAP5 CIRCADIAN TIMEKEEPER	84.242%	Swiss-Prot	weak database homology
`B8BDW1`	Oryza sativa subsp. indica	Protein XAP5 CIRCADIAN TIMEKEEPER	84.242%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card