RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G147280
Reference: TK1151 Chr: Chr01 Coordinates: 37247506-37252179 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2949 bp · TkA01G147280|TK1151|cDNA

GAAGGAAAGAGTGTGTGGGTTACATTGTACGGTCTCAGCTTTGTCCCCCCACCCCACCCCCAACTAATACTGTAATCTTTCTCTCTAAAAAGCTAGAAAGACACTGCCCCTTTGGCTTTTTTCCCCTTTGGTTTTTGTGCTGCCTTTGCATTTGTCCATGTCTTGCTCCCTTCTTCAAACCCACCCAAATCCCAGCTCTCAAAACTAGATAATGGGGTGGCAATCATACCATCAATTCTCGTAGAATTTCTTCCCTTCTG...

CDS

Download CDS FASTA

2265 bp · TkA01G147280|TK1151|CDS

ATGGAAATTGATCTGAACCATGCAGCGAATGGGATTGAGGTTATGGAGAAGCTTTATAGCGTTGATTCGAGTGGAAATGGAGGGGATTCGTCTTTATCAGCTTCGTCAAACTCCTCGAATTCGTCTCTAAAACAATCAAATCCCAATTTTGAATCATCGGTTTATATGGAGCTTTGGCATGCCTGTGCTGGGCCTCTCACAACTCTCCCAAATAAAGGAAATGTGGTTGTTTATTTCCCACAAGGTCACTTAGAACAAAC...

Protein

Download Protein FASTA

754 aa · TkA01G147280|TK1151|PROTEIN

MEIDLNHAANGIEVMEKLYSVDSSGNGGDSSLSASSNSSNSSLKQSNPNFESSVYMELWHACAGPLTTLPNKGNVVVYFPQGHLEQTASHSSIHFSPMEVPSFGLQPQIFCKVIDVKLLANKENDEIYTKLTLLPLPELTDKNLQEGEEEGGGGTLTKSTPQMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYKQQRPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRGEGGELWL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G147280
TK1151 IDTkA01G147280
OH-1004 IDLXL04_004461
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G147280
LocationChr01:37247506-37252179 (+)
DescriptionSimilar to ARF4: Auxin response factor 4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g60450 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
At5g62000 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
AUXIN RESPONSE FACTOR 2 (ARF2): a pleiotropic developmental regulator.2005 · DOI: 10.1111/j.1365-313x.2005.02426.x
AUXIN RESPONSE FACTOR1 and AUXIN RESPONSE FACTOR2 regulate senescence and floral organ abscission in Arabidopsis thaliana.2005 · DOI: 10.1242/dev.02012
The AUXIN RESPONSE FACTOR 2 gene of Arabidopsis links auxin signalling, cell division, and the size of seeds and other organs.2006 · DOI: 10.1242/dev.02194

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0927600 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Os05g0563400 Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004461 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009850 auxin metabolic process Biological Process
GO:0010050 vegetative phase change Biological Process
GO:0010158 abaxial cell fate specification Biological Process
GO:0010582 floral meristem determinacy Biological Process
GO:1902584 positive regulation of response to water deprivation Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference
ath:AT2G33860
ath:AT5G60450
dosa:Os01g0670800
dosa:Os01g0753500
dosa:Os05g0563400
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971
Rank 1 · TkA01G147280 · TK1151
Cytoplasm0.082
Rank 2 · TkA01G147280 · TK1151
Cell membrane0.026
Rank 3 · TkA01G147280 · TK1151
Endoplasmic reticulum0.014
Rank 4 · TkA01G147280 · TK1151
Plastid0.013
Rank 5 · TkA01G147280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07655Secretin_N_221-81 aa
PF25313BRWD_AD69-122 aa
PF02362B3164-265 aa
PF25313BRWD_AD292-393 aa
PF06507ARF_AD313-394 aa
PF07655Secretin_N_2596-646 aa
PF02309AUX_IAA636-675 aa
PF00564PB1650-700 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G147280PF07655Secretin_N_221810.0714.4
TkA01G147280PF25313BRWD_AD691225.7e-1143.4
TkA01G147280PF02362B31642651.9e-2383.0
TkA01G147280PF25313BRWD_AD2923935.7e-1143.4
TkA01G147280PF06507ARF_AD3133941e-31109.4
TkA01G147280PF07655Secretin_N_25966460.0714.4
TkA01G147280PF02309AUX_IAA6366751.4e-1042.1
TkA01G147280PF00564PB16507000.04114.6
TkA01G147280PF02362B36807101.9e-2383.0
TkA01G147280PF02309AUX_IAA6857221.4e-1042.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZTX9Arabidopsis thalianasp|Q9ZTX9|ARFD_ARATH Auxin response factor 455.700%Swiss-ProtHigh
Q94JM3Arabidopsis thalianasp|Q94JM3|ARFB_ARATH Auxin response factor 237.400%Swiss-ProtMedium
Q5JK20Oryza sativa subsp. japonicasp|Q5JK20|ARFD_ORYSJ Auxin response factor 437.500%Swiss-ProtMedium
Q8S985Oryza sativa subsp. japonicasp|Q8S985|ARFO_ORYSJ Auxin response factor 1547.900%Swiss-ProtMedium

JBrowse

View in Genome Browser