TkA01G138970 | RubberDandelionOmics

Gene overview

TkA01G138970

Reference: TK1151 Chr: Chr01 Coordinates: 35297472-35300525 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2726 bp · TkA01G138970|TK1151|cDNA

CACATTCCTCTCCTTCTCTCATCTCTCCACCTTCTTCTTCTTCACATTCTGCAATTCCTTCGTGTTTATGGTACAGAAGCTCCGGTAACAACAATGGAGTACTCCGATGCCTCACACGGCTATATTAAGGAATACCAATCGCTTTTTACAGCGTTAGAAACCGAGTTACTGGAAGTCGAGCATTTCTTCAGAGAACCTAATTTGAATGACGCGATTGATGGAGTTTTAAGTTCCGATGTTTTCAGTTTACACAAATGTCG...

CDS

Download CDS FASTA

882 bp · TkA01G138970|TK1151|CDS

CACATTCCTCTCCTTCTCTCATCTCTCCACCTTCTTCTTCTTCACATTCTGCAATTCCTTCGTGTTTATGGTACAGAAGCTCCGGTAACAACAATGGAGTACTCCGATGCCTCACACGGCTATATTAAGGAATACCAATCGCTTTTTACAGCGTTAGAAACCGAGTTACTGGAAGTCGAGCATTTCTTCAGAGAACCTAATTTGAATGACGCGATTGATGGAGTTTTAAGTTCCGATGTTTTCAGTTTACACAAATGTCG...

Protein

Download Protein FASTA

293 aa · TkA01G138970|TK1151|PROTEIN

HIPLLLSSLHLLLLHILQFLRVYGTEAPVTTMEYSDASHGYIKEYQSLFTALETELLEVEHFFREPNLNDAIDGVLSSDVFSLHKCRNVATPGDVIDSIPDVLELEDYILDFVNDEATRSMPEKIMDCNTAGEVNPLARIFRFKTKPRGRNVKRGKPATYDYLKSFWYRDRRFVAVYDGGKKSENIGRRKRHKSWTIPEVLKLIDGVSQLGVGKWTEIKRLFFSSCHHRSAVDLKDKWRNLLRASCKLPCVKLKGEWVEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G138970`
TK1151 ID	TkA01G138970
OH-1004 ID	LXL04_004518
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 94.539 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G138970

Location Chr01:35297472-35300525 (+)

Description Similar to TBP1: Telomere-binding protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0817800`	Binds the telomeric double-stranded 5'TTTAGGG-3' repeat and regulates telomere length and structure.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004518 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003691 double-stranded telomeric DNA binding Molecular Function

GO:0008301 DNA binding, bending Molecular Function

GO:0042162 telomeric DNA binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G07540

ath:AT3G12560

ath:AT3G53790

ath:AT5G13820

dosa:Os02g0817800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.967

Rank 1 · TkA01G138970 · TK1151

Cytoplasm0.082

Rank 2 · TkA01G138970 · TK1151

Cell membrane0.025

Rank 3 · TkA01G138970 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA01G138970 · TK1151

Plastid0.013

Rank 5 · TkA01G138970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13873Myb_DNA-bind_5191-205 aa

PF00249Myb_DNA-binding193-242 aa

PF13837Myb_DNA-bind_4194-243 aa

PF23588HTH_CHD1_Hrp3194-220 aa

PF13921Myb_DNA-bind_6195-247 aa

PF13873Myb_DNA-bind_5214-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G138970	`PF13873`	Myb_DNA-bind_5	191	205	0.0026	18.3
TkA01G138970	`PF00249`	Myb_DNA-binding	193	242	3.2e-07	31.1
TkA01G138970	`PF13837`	Myb_DNA-bind_4	194	243	0.068	14.3
TkA01G138970	`PF23588`	HTH_CHD1_Hrp3	194	220	0.13	13.0
TkA01G138970	`PF13921`	Myb_DNA-bind_6	195	247	5.2e-05	24.1
TkA01G138970	`PF13873`	Myb_DNA-bind_5	214	243	0.0026	18.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LL45`	Oryza sativa subsp. japonica	sp\|Q9LL45\|TBP1_ORYSJ Telomere-binding protein 1	38.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card