LXL04_004518 | RubberDandelionOmics

Gene overview

LXL04_004518

Reference: OH-1004 Chr: Chr01 Coordinates: 139024304-139025514 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

882 bp · LXL04_004518|LXL04_004518|OH1004|cDNA

CACATTCCTCTCCTTCTCTCATCTCTccaccttcttcttcttcacatTCTGCAATTCCTTCGTGTTTATGGTACAGAAGCTCCGGTAACAACAATGGAGTACTCCGATGCCTCACACGGCTATATTAAGGAATACCAATCGCTTTTTACAGCGTTAGAAACCGAGTTACTGGAAGTCGAGCATTTCTTCAGAGAACCTAATTTGAATGACGCGATTGATGGAGTTTTAAGTTCCGATGTTTTCAGTTTACACAAATGTCG...

CDS

Download CDS FASTA

834 bp · LXL04_004518|LXL04_004518|OH1004|CDS

CTGCAATTCCTTCGTGTTTATGGTACAGAAGCTCCGGTAACAACAATGGAGTACTCCGATGCCTCACACGGCTATATTAAGGAATACCAATCGCTTTTTACAGCGTTAGAAACCGAGTTACTGGAAGTCGAGCATTTCTTCAGAGAACCTAATTTGAATGACGCGATTGATGGAGTTTTAAGTTCCGATGTTTTCAGTTTACACAAATGTCGTAACGTCGCTACTCCTGGTGATGTGATAGATAGTATTCCAGACGTACT...

Protein

Download Protein FASTA

277 aa · LXL04_004518|LXL04_004518|OH1004|PROTEIN

MQFLRVYGTEAPVTTMEYSDASHGYIKEYQSLFTALETELLEVEHFFREPNLNDAIDGVLSSDVFSLHKCRNVATPGDVIDSIPDVLELEDYILDFVNDEATRSMPEKIMDCNTAGEVNPLARIFRFKTKPRGRNVKRGKPATYDYLKSFWYRDRRFVAVYDGGKKSENIGRRKRHKSWTIPEVLKLIDGVSQLGVGKWTEIKRLFFSSCHHRSAVDLKDKWRNLLRASCKLPCVKLKGEWVEGNGSPTTPHHILCRVRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004518`
TK1151 ID	TkA01G138970
OH-1004 ID	LXL04_004518
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 94.539 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004518

Location Chr01:139024304-139025514 (-)

Description Similar to TBP1: Telomere-binding protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53790`	Binds specifically to the plant telomeric double-stranded DNA sequences.	No verified direct reference in this release
`At3g12560`	Binds specifically to the plant telomeric double-stranded DNA sequences.	No verified direct reference in this release
`At5g13820`	Binds specifically to the plant telomeric double-stranded DNA sequences 5'-TTTAGGG-3'.	No verified direct reference in this release
`At1g07540`	Binds specifically to the plant telomeric double-stranded DNA sequences.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0817800`	Binds the telomeric double-stranded 5'TTTAGGG-3' repeat and regulates telomere length and structure.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004518 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003691 double-stranded telomeric DNA binding Molecular Function

GO:0008301 DNA binding, bending Molecular Function

GO:0042162 telomeric DNA binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G07540

ath:AT3G12560

ath:AT3G53790

ath:AT5G13820

dosa:Os02g0817800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · LXL04_004518 · OH-1004

Cytoplasm0.077

Rank 2 · LXL04_004518 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_004518 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_004518 · OH-1004

Plastid0.012

Rank 5 · LXL04_004518 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding177-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004518	`PF00249.38`	Myb_DNA-binding	177	226	3.1e-07	31.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M347`	Arabidopsis thaliana	Telomere repeat-binding protein 6	35.484%	Swiss-Prot	weak database homology
`Q9C7B1`	Arabidopsis thaliana	Telomere repeat-binding protein 3	32.258%	Swiss-Prot	weak database homology
`Q9FFY9`	Arabidopsis thaliana	Telomere repeat-binding protein 4	31.373%	Swiss-Prot	weak database homology
`Q6R0E3`	Arabidopsis thaliana	Telomere repeat-binding protein 5	32.979%	Swiss-Prot	weak database homology
`Q9LL45`	Oryza sativa subsp. japonica	Telomere-binding protein 1	38.235%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card