TkA01G131620 | RubberDandelionOmics

Gene overview

TkA01G131620

Reference: TK1151 Chr: Chr01 Coordinates: 33277341-33278151 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

579 bp · TkA01G131620|TK1151|cDNA

ATGCAAGCTGCAACACTTCCACTTATATCCCACTCAACTCGCTCCACCCATCCGACATCATCGATACTCGACGTAAATGGCGCCGAAGAAGAAATCCTTCAAGCTGCGACTCCGCCTCCGACTCCGACCCCAGAAAAACAGGGGCAACCCAAGAAAACCACCGCCCGTGATAGCGGTGGGGGGAAGAAGGCGGCGGAGGGGAATGAGGGTAAGAAGAGGAGGAAGAGGAGGAAGGTGGGGGAGAATGGTGGCGGAGAAGG...

CDS

Download CDS FASTA

579 bp · TkA01G131620|TK1151|CDS

ATGCAAGCTGCAACACTTCCACTTATATCCCACTCAACTCGCTCCACCCATCCGACATCATCGATACTCGACGTAAATGGCGCCGAAGAAGAAATCCTTCAAGCTGCGACTCCGCCTCCGACTCCGACCCCAGAAAAACAGGGGCAACCCAAGAAAACCACCGCCCGTGATAGCGGTGGGGGGAAGAAGGCGGCGGAGGGGAATGAGGGTAAGAAGAGGAGGAAGAGGAGGAAGGTGGGGGAGAATGGTGGCGGAGAAGG...

Protein

Download Protein FASTA

192 aa · TkA01G131620|TK1151|PROTEIN

MQAATLPLISHSTRSTHPTSSILDVNGAEEEILQAATPPPTPTPEKQGQPKKTTARDSGGGKKAAEGNEGKKRRKRRKVGENGGGEGHKRYLYRVMKQVHPDLGISSKAMTIINNLMADMFEKLAEDAARLSDYNKKMAMTAREIQAAVKLVLPGELGKHAVAEGTKAVNNYVSYGGGKGGGRDCESESQAF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G131620`
TK1151 ID	TkA01G131620
OH-1004 ID	LXL04_004596
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	71.200
Protein coverage (%)	TK1151 100.000 / OH-1004 87.925 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G131620

Location Chr01:33277341-33278151 (+)

Description Similar to At1g08170: Histone H2B.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08170`	Core component of nucleosome.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WWU2`	Core component of nucleosome.	No verified direct reference in this release
`Os01g0839500`	Core component of nucleosome.	No verified direct reference in this release
`UniProt: A2XF66`	Core component of nucleosome.	No verified direct reference in this release
`Os03g0279000`	Core component of nucleosome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004596 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0019731 antibacterial humoral response Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0050830 defense response to Gram-positive bacterium Biological Process

GO:0061644 protein localization to CENP-A containing chromatin Biological Process

GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G08170

mmu:319178

mmu:319180

mmu:319183

mmu:319185

mmu:319187

mmu:665596

mmu:665622

xla:121402223

xla:121402228

xla:121402236

xla:121402237

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA01G131620 · TK1151

Cytoplasm0.088

Rank 2 · TkA01G131620 · TK1151

Cell membrane0.016

Rank 3 · TkA01G131620 · TK1151

Endoplasmic reticulum0.010

Rank 4 · TkA01G131620 · TK1151

Mitochondrion0.008

Rank 5 · TkA01G131620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125Histone71-151 aa

PF03428RP-C76-122 aa

PF00808CBFD_NFYB_HMF94-149 aa

PF26281Histone_ABTB105-176 aa

PF03428RP-C119-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G131620	`PF00125`	Histone	71	151	2.7e-17	63.6
TkA01G131620	`PF03428`	RP-C	76	122	0.03	14.8
TkA01G131620	`PF00808`	CBFD_NFYB_HMF	94	149	0.0023	18.9
TkA01G131620	`PF26281`	Histone_ABTB	105	176	1.9e-07	31.5
TkA01G131620	`PF03428`	RP-C	119	150	0.03	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGE3`	Arabidopsis thaliana	sp\|Q9SGE3\|H2B2_ARATH Histone H2B.2	65.900%	Swiss-Prot	Low
`A2WWU2`	Oryza sativa subsp. indica	sp\|A2WWU2\|H2B11_ORYSI Histone H2B.11	64.000%	Swiss-Prot	Low
`Q943L2`	Oryza sativa subsp. japonica	sp\|Q943L2\|H2B11_ORYSJ Histone H2B.11	64.000%	Swiss-Prot	Low
`A2XF66`	Oryza sativa subsp. indica	sp\|A2XF66\|H2B1_ORYSI Histone H2B.1	64.000%	Swiss-Prot	Low
`A3AGM4`	Oryza sativa subsp. japonica	sp\|A3AGM4\|H2B1_ORYSJ Histone H2B.1	64.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card