LXL04_004596 | RubberDandelionOmics

Gene overview

LXL04_004596

Reference: OH-1004 Chr: Chr01 Coordinates: 141234432-141235338 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_004596|LXL04_004596|OH1004|cDNA

ATGTTCATTTTTCATAGTTTTACCACACGTAGCAACCCGACTCAGAAAAATCCTGCCACGTGCGCTCCACGTGCTGACTGTACAGCCCCTCCATCCATGCAAGCTGCAACACTTCCACTTATATCCCACTCAACTCGCTCCACCCATCCGACATCATCGATACTCGACGTAAATGGCACCGAAGAAGAAATCCAAAATGTCGAAATCTTCACTGTAAAAACCCCAGTACAACAAGAAACCCTAGAAGACTATGACACCCA...

CDS

Download CDS FASTA

798 bp · LXL04_004596|LXL04_004596|OH1004|CDS

ATGTTCATTTTTCATAGTTTTACCACACGTAGCAACCCGACTCAGAAAAATCCTGCCACGTGCGCTCCACGTGCTGACTGTACAGCCCCTCCATCCATGCAAGCTGCAACACTTCCACTTATATCCCACTCAACTCGCTCCACCCATCCGACATCATCGATACTCGACGTAAATGGCACCGAAGAAGAAATCCAAAATGTCGAAATCTTCACTGTAAAAACCCCAGTACAACAAGAAACCCTAGAAGACTATGACACCCA...

Protein

Download Protein FASTA

265 aa · LXL04_004596|LXL04_004596|OH1004|PROTEIN

MFIFHSFTTRSNPTQKNPATCAPRADCTAPPSMQAATLPLISHSTRSTHPTSSILDVNGTEEEIQNVEIFTVKTPVQQETLEDYDTQLEDGGEDFKNGGETREIKVQAATPPPTPTPEKQGQPKKTTARDSGGGKKAAEGNEGKKRRKRRKVGENGGGEGHKRYLYRVMKQVHPDLGISSKAMTIIKNLMADMFEKLAEDAARLSDYNKKMAMTAREIQAAVKLVLPGELGKHAVAEGTKAVNNYVSYGGGKGGGRDCES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004596`
TK1151 ID	TkA01G131620
OH-1004 ID	LXL04_004596
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	71.200
Protein coverage (%)	TK1151 100.000 / OH-1004 87.925 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004596

Location Chr01:141234432-141235338 (-)

Description Similar to At1g08170: Histone H2B.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08170`	Core component of nucleosome.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004596 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006325 chromatin organization Biological Process

GO:0019731 antibacterial humoral response Biological Process

GO:0031507 heterochromatin formation Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0050830 defense response to Gram-positive bacterium Biological Process

GO:0061644 protein localization to CENP-A containing chromatin Biological Process

GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide Biological Process

GO:0000786 nucleosome Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G08170

mmu:319178

mmu:319180

mmu:319183

mmu:319185

mmu:319187

mmu:665596

mmu:665622

xla:121402223

xla:121402228

xla:121402236

xla:121402237

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · LXL04_004596 · OH-1004

Cytoplasm0.112

Rank 2 · LXL04_004596 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_004596 · OH-1004

Mitochondrion0.011

Rank 4 · LXL04_004596 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_004596 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00125.31Histone144-224 aa

PF26281.1Histone_ABTB178-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004596	`PF00125.31`	Histone	144	224	1.4e-16	61.3
LXL04_004596	`PF26281.1`	Histone_ABTB	178	249	3.5e-07	30.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGE3`	Arabidopsis thaliana	Histone H2B.2	51.351%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card