TkA01G130630 | RubberDandelionOmics

Gene overview

TkA01G130630

Reference: TK1151 Chr: Chr01 Coordinates: 32983965-32986121 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1981 bp · TkA01G130630|TK1151|cDNA

TTTAAAACATCATGTGAAATACGTTTTCTCCCCCCGAAAAGGAATTATAAACCCTAGAGAGAACCCAACTTCTTAGATACACTCCTTTTGTTTTCTCTTTTTTAAAAAAGGCGATACAATCTCTTTCGGCTATTCATTCCAGATCGGTTGCAATCGGTTGATTTGGTAGTTGAACTCACTTCATCTTTTTTGCCGGGCACCTAATCGCGTAGTGTTAAACTTTCGATGGCTGAGGAAGATAACAATAATGATAGAAGAAA...

CDS

Download CDS FASTA

1512 bp · TkA01G130630|TK1151|CDS

ATGGCTGAGGAAGATAACAATAATGATAGAAGAAACGGCGGCGCCGGCGATGATCGGAGCGATGCAAGCGATTACACTTCAGATGACGAAGGAACGGAGGATTACAGGCGCGGAGGTTATCACGCTGTTCGTATTGGTGATACGTTTAAGCACTCGAGATATGTTGTTCAGAGCAAACTCGGCTGGGGCCATTTTTCCACCGTCTGGCTCGCTTGGGACACTCACAAATCTAGATATGTAGCTTTAAAAGTCCAAAAAAG...

Protein

Download Protein FASTA

503 aa · TkA01G130630|TK1151|PROTEIN

MAEEDNNNDRRNGGAGDDRSDASDYTSDDEGTEDYRRGGYHAVRIGDTFKHSRYVVQSKLGWGHFSTVWLAWDTHKSRYVALKVQKSAQHYNEAAMDEITILKQIAEGDTDDKKCVVKLLDHFKHSGPNGQHVCMVFEYLGDNLLTLIKYSDYRGIPLHKVKQICYHVLGGLDYLHHQLSIIHTDLKPENILLLSTIDPEKDPRKTGAPLILPSEKVSTDSGASKHSQPSNGDLTKNQKKKIRKKAKKAAQNTSGKEESE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G130630`
TK1151 ID	TkA01G130630
OH-1004 ID	LXL04_004613
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G130630`
Location	Chr01:32983965-32986121 (-)
Description	Similar to Serine/threonine-protein kinase SRPK
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004613` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000245 spliceosomal complex assembly Biological Process GO:0006468 protein phosphorylation Biological Process GO:0007059 chromosome segregation Biological Process GO:0007088 regulation of mitotic nuclear division Biological Process GO:0008380 RNA splicing Biological Process GO:0018105 peptidyl-serine phosphorylation Biological Process GO:0030154 cell differentiation Biological Process GO:0035092 sperm DNA condensation Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0045070 positive regulation of viral genome replication Biological Process GO:0045071 negative regulation of viral genome replication Biological Process GO:0045087 innate immune response Biological Process
KEGG gene cross-reference	hsa:6732 pon:100172042 spo:2539847 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.601

Rank 1 · TkA01G130630 · TK1151

Cytoplasm0.457

Rank 2 · TkA01G130630 · TK1151

Mitochondrion0.056

Rank 3 · TkA01G130630 · TK1151

Cell membrane0.054

Rank 4 · TkA01G130630 · TK1151

Endoplasmic reticulum0.029

Rank 5 · TkA01G130630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase54-194 aa

PF07714PK_Tyr_Ser-Thr56-194 aa

PF12569NatA_aux_su224-282 aa

PF07714PK_Tyr_Ser-Thr284-348 aa

PF00069Pkinase290-454 aa

PF07714PK_Tyr_Ser-Thr421-450 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G130630	`PF00069`	Pkinase	54	194	4.7e-45	154.8
TkA01G130630	`PF07714`	PK_Tyr_Ser-Thr	56	194	3e-18	66.8
TkA01G130630	`PF12569`	NatA_aux_su	224	282	0.35	10.5
TkA01G130630	`PF07714`	PK_Tyr_Ser-Thr	284	348	3e-18	66.8
TkA01G130630	`PF00069`	Pkinase	290	454	4.7e-45	154.8
TkA01G130630	`PF07714`	PK_Tyr_Ser-Thr	421	450	3e-18	66.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card