Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1494 bp · LXL04_004613|LXL04_004613|OH1004|cDNA
ATGGCGGAGGAAGATAACAATAATGATAGAAGAAACGGCGGCGCCGGCGATGATCGGAGCGATGCAAGCGATTACACTTCAGATGACGAAGGAACGGAGGATTACAGGCGCGGAGGTTATCACGCTATTCGTATTGGTGATACGTTTAAGCACTCGAGATATGTTGTTCAGAGCAAACTCGGCTGGGGCCATTTTTCCACCGTCTGGCTCGCTTGGGACACTCACAAATCTAGATATGTAGCTTTAAAAGTCCAAAAAAG...
1494 bp · LXL04_004613|LXL04_004613|OH1004|CDS
ATGGCGGAGGAAGATAACAATAATGATAGAAGAAACGGCGGCGCCGGCGATGATCGGAGCGATGCAAGCGATTACACTTCAGATGACGAAGGAACGGAGGATTACAGGCGCGGAGGTTATCACGCTATTCGTATTGGTGATACGTTTAAGCACTCGAGATATGTTGTTCAGAGCAAACTCGGCTGGGGCCATTTTTCCACCGTCTGGCTCGCTTGGGACACTCACAAATCTAGATATGTAGCTTTAAAAGTCCAAAAAAG...
Protein
Download Protein FASTA497 aa · LXL04_004613|LXL04_004613|OH1004|PROTEIN
MAEEDNNNDRRNGGAGDDRSDASDYTSDDEGTEDYRRGGYHAIRIGDTFKHSRYVVQSKLGWGHFSTVWLAWDTHKSRYVALKVQKSAQHYTEAAMDEITILKQIAEGDPDDKKCVVKLLDHFKHSGPNGQHVCMVFEYLGDNLLTLIKYSDYRGIPLHKVKQICYHVLGGLDYLHHQLSIIHTDLKPENILLLSTIDPEKDLRKTGAPLILPSEKVPTDSGASKHSQPSNGDLTKNQKKKIRKKAKKAAQNTAGKEESE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_004613 |
|---|---|
| TK1151 ID | TkA01G130630 |
| OH-1004 ID | LXL04_004613 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 96.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_004613 |
|---|---|
| Location | Chr01:141519306-141520970 (+) |
| Description | Similar to Serine/threonine-protein kinase SRPK |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000245 spliceosomal complex assembly Biological Process GO:0006468 protein phosphorylation Biological Process GO:0007059 chromosome segregation Biological Process GO:0007088 regulation of mitotic nuclear division Biological Process GO:0008380 RNA splicing Biological Process GO:0018105 peptidyl-serine phosphorylation Biological Process GO:0030154 cell differentiation Biological Process GO:0035092 sperm DNA condensation Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0045070 positive regulation of viral genome replication Biological Process GO:0045071 negative regulation of viral genome replication Biological Process GO:0045087 innate immune response Biological Process |
| KEGG gene cross-reference | hsa:6732 pon:100172042 spo:2539847 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069.32Pkinase54-194 aaPF07714.24PK_Tyr_Ser-Thr56-194 aaPF07714.24PK_Tyr_Ser-Thr284-348 aaPF00069.32Pkinase290-454 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_004613 | PF00069.32 | Pkinase | 54 | 194 | 3.5e-45 | 155.2 |
| LXL04_004613 | PF07714.24 | PK_Tyr_Ser-Thr | 56 | 194 | 3.1e-18 | 66.7 |
| LXL04_004613 | PF07714.24 | PK_Tyr_Ser-Thr | 284 | 348 | 3.1e-18 | 66.7 |
| LXL04_004613 | PF00069.32 | Pkinase | 290 | 454 | 3.5e-45 | 155.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.