TkA01G128580 | RubberDandelionOmics

Gene overview

TkA01G128580

Reference: TK1151 Chr: Chr01 Coordinates: 32478337-32479532 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

699 bp · TkA01G128580|TK1151|cDNA

TTCATTTGACCGCAGAACCCTAACGCCCACACCAACGTAGCGAAAATACACAGCGGCTGTAACAGCGATTGCAGAATGAAGGTTGTCGCCGCCTATTTGTTGGCTCTCTTGGGAGGTAACACTACCCCATCCGCTGAAGATTTGAAGAAAATCCTCGGCTCAGTTGGAGCTGATGCCGATGATGATAGAATTGAATTGCTCTTGTCTGAGGTCAAGGGTAAAGATATCACCGAGTTGGTTGCAGCCGGAAGGGAAAAGTT...

CDS

Download CDS FASTA

345 bp · TkA01G128580|TK1151|CDS

ATGAAGGTTGTCGCCGCCTATTTGTTGGCTCTCTTGGGAGGTAACACTACCCCATCCGCTGAAGATTTGAAGAAAATCCTCGGCTCAGTTGGAGCTGATGCCGATGATGATAGAATTGAATTGCTCTTGTCTGAGGTCAAGGGTAAAGATATCACCGAGTTGGTTGCAGCCGGAAGGGAAAAGTTAGCTTCAGTTCCTTCCGGTGGTGGTGGTGTTGCCATTGCCGCCTCCGCTGGTGGTGGTGCTGCACCTGCTGCCGC...

Protein

Download Protein FASTA

114 aa · TkA01G128580|TK1151|PROTEIN

MKVVAAYLLALLGGNTTPSAEDLKKILGSVGADADDDRIELLLSEVKGKDITELVAAGREKLASVPSGGGGVAIAASAGGGAAPAAAAAAEPKKEEKVEEKEESDDDMGFSLFD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G128580`
TK1151 ID	TkA01G128580
OH-1004 ID	LXL04_004651
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 94.215 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G128580

Location Chr01:32478337-32479532 (+)

Description Similar to RPP2B: 60S acidic ribosomal protein P2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27710`	Plays an important role in the elongation step of protein synthesis.	No verified direct reference in this release
`At3g44590`	Plays an important role in the elongation step of protein synthesis.	No verified direct reference in this release
`At2g27720`	Plays an important role in the elongation step of protein synthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004651 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002182 cytoplasmic translational elongation Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0000036 acyl carrier activity Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

GO:0044877 protein-containing complex binding Molecular Function

KEGG gene cross-reference

ath:AT3G44590

zma:542323

zma:542340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.850

Rank 1 · TkA01G128580 · TK1151

Nucleus0.167

Rank 2 · TkA01G128580 · TK1151

Endoplasmic reticulum0.107

Rank 3 · TkA01G128580 · TK1151

Cell membrane0.071

Rank 4 · TkA01G128580 · TK1151

Golgi apparatus0.043

Rank 5 · TkA01G128580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29070MSC6_N4-43 aa

PF00428Ribosomal_60s18-113 aa

PF17827PrmC_N25-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G128580	`PF29070`	MSC6_N	4	43	0.11	12.2
TkA01G128580	`PF00428`	Ribosomal_60s	18	113	9.1e-25	87.7
TkA01G128580	`PF17827`	PrmC_N	25	62	0.22	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLF7`	Arabidopsis thaliana	sp\|Q9SLF7\|RLA22_ARATH Large ribosomal subunit protein P2y	72.100%	Swiss-Prot	Medium
`Q9LXM8`	Arabidopsis thaliana	sp\|Q9LXM8\|RLA24_ARATH Large ribosomal subunit protein P2w	70.600%	Swiss-Prot	Medium
`P51407`	Arabidopsis thaliana	sp\|P51407\|RLA21_ARATH Large ribosomal subunit protein P2z	70.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card