RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G122070
Reference: TK1151 Chr: Chr01 Coordinates: 30918875-30924020 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2282 bp · TkA01G122070|TK1151|cDNA

ATTTTCTTGAAGTTTTTTATTCATTCATTGTTTGTCTTCAAACCCCACAAAGAGAAGAAGAAAGGGGATATGTTGCAAGGACAAGATTTGTGTACTAGCCTATATGAGCTTCAAAATCCGTTGATAAGTTAATTTATCATAGAGATAAGGAAACCCTAGCGAACAATCAAACCAGGTTTCTTCATAAAGAAGGTGAAAGAAAGAAGATTAAGACCCCATGAAAGATGAAAAGTTGAAATGCTAAAAGAGAGACAGAAAGA...

CDS

Download CDS FASTA

1509 bp · TkA01G122070|TK1151|CDS

ATGGCGAGTCACCGAGTTGGAGAGACCGGTTTGTCAGACTCAGGACCTTCACACCATCACCATCACCACCAACACCTGCCATACTCTGTTTTTCCTGCCTTTAATCCTCCTAACACCGCCTTCATTAACCAAGAAGGGTCGTCGTTCGATTTTGGGGAGCTAGAAGAAGCTATAGTGCTTCAAGGTTACAACAAGATCCATGGTGATGAAACCAAATTACCTTTATACGCTACAGTACCAAGGCCAGCAGCTACTCTGGA...

Protein

Download Protein FASTA

502 aa · TkA01G122070|TK1151|PROTEIN

MASHRVGETGLSDSGPSHHHHHHQHLPYSVFPAFNPPNTAFINQEGSSFDFGELEEAIVLQGYNKIHGDETKLPLYATVPRPAATLDMFPSWPMRVHQTPRGSNSSTDSGSAVNVAIPGKPETHSHIEPESPISSNSKKASSNQNQQQEQQHQQAIFRQQLQNLQIPEQNLEMESEGGSPVTTGGSSHSQQALKPFSEKTLRRLAQNREAARKSRLRKKAYVQQLETSRIRLTQLEQDLQRARSQGLFMSGGGGGGNLSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G122070
TK1151 IDTkA01G122070
OH-1004 IDLXL04_004690
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)96.100
Protein coverage (%)TK1151 100.000 / OH-1004 96.455
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G122070
LocationChr01:30918875-30924020 (+)
DescriptionSimilar to TGA9: Transcription factor TGA9
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g08320 Together with TGA10, basic leucine-zipper transcription factor required for anther development, probably via the activation of SPL expression in anthers and via the regulation of genes with functions in early and middle tapetal development.
Arabidopsis basic leucine-zipper transcription factors TGA9 and TGA10 interact with floral glutaredoxins ROXY1 and ROXY2 and are redundantly required for anther development.2010 · DOI: 10.1104/pp.110.159111
Arabidopsis clade IV TGA transcription factors, TGA10 and TGA9, are involved in ROS-mediated responses to bacterial PAMP flg22.2016 · DOI: 10.1016/j.plantsci.2016.06.019

Rice

Reference gene IDPossible functionPapers / DOI
Os11g0152700 Transcriptional regulator involved in defense response. No verified direct reference in this release
Os12g0152900 Transcriptional regulator involved in defense response. No verified direct reference in this release
Os01g0859500 Transcriptional regulator involved in defense response (By similarity). No verified direct reference in this release
Os05g0443900 Transcriptional regulator involved in defense response. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004690 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002237 response to molecule of bacterial origin Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006952 defense response Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0048653 anther development Biological Process
GO:0071588 hydrogen peroxide mediated signaling pathway Biological Process
GO:1905623 positive regulation of leaf development Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
GO:0042803 protein homodimerization activity Molecular Function
GO:0043565 sequence-specific DNA binding Molecular Function
KEGG gene cross-reference
ath:AT1G08320
dosa:Os01g0859500
dosa:Os05g0443900
dosa:Os11g0152700
osa:4338933
osa:4349800
zma:541670
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.853
Rank 1 · TkA01G122070 · TK1151
Cytoplasm0.214
Rank 2 · TkA01G122070 · TK1151
Cell membrane0.041
Rank 3 · TkA01G122070 · TK1151
Endoplasmic reticulum0.027
Rank 4 · TkA01G122070 · TK1151
Mitochondrion0.018
Rank 5 · TkA01G122070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03153TFIIA120-218 aa
PF01481Arteri_nucleo138-163 aa
PF07716bZIP_2148-163 aa
PF07716bZIP_2198-240 aa
PF01481Arteri_nucleo198-271 aa
PF00170bZIP_1199-239 aa
PF00535Glycos_transf_2253-315 aa
PF14144DOG1279-353 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G122070PF03153TFIIA1202183.78.1
TkA01G122070PF01481Arteri_nucleo1381630.1213.4
TkA01G122070PF07716bZIP_21481633.1e-0524.6
TkA01G122070PF07716bZIP_21982403.1e-0524.6
TkA01G122070PF01481Arteri_nucleo1982710.1213.4
TkA01G122070PF00170bZIP_11992392.3e-0731.5
TkA01G122070PF00535Glycos_transf_22533150.06413.9
TkA01G122070PF14144DOG12793534.8e-33113.9
TkA01G122070PF03153TFIIA3743893.78.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93XM6Arabidopsis thalianasp|Q93XM6|TGA9_ARATH Transcription factor TGA960.400%Swiss-ProtHigh
Q53Q70Oryza sativa subsp. japonicasp|Q53Q70|TGAL4_ORYSJ Transcription factor TGAL450.400%Swiss-ProtHigh
Q2QXL0Oryza sativa subsp. japonicasp|Q2QXL0|TGL11_ORYSJ Transcription factor TGAL1169.900%Swiss-ProtMedium
Q5N7C7Oryza sativa subsp. japonicasp|Q5N7C7|LG2_ORYSJ Transcription factor LG265.800%Swiss-ProtHigh
Q6F2N0Oryza sativa subsp. japonicasp|Q6F2N0|TGAL5_ORYSJ Transcription factor TGAL554.200%Swiss-ProtHigh

JBrowse

View in Genome Browser