TkA01G109180 | RubberDandelionOmics

Gene overview

TkA01G109180

Reference: TK1151 Chr: Chr01 Coordinates: 27701886-27703573 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · TkA01G109180|TK1151|cDNA

CATACTAACCCACGAAGCTATCCCCCCACAAAACCCCTATCTTCATTTATCCCTTCACTTATCAGTCATCACATCTACACCTTAAAATCATACTCCAACAATCCACACACAAGGTCACCAAACGCAACAATGGCTTCCTCATCTGCTTCGGCAGCTCTTCTTTCTTCTCCAAATCCTAGATTATCCACCTCCATTTCTCCCAAATCCAAGCTCTCTCAAACCCTAGCATTCTCCAGCTCCCCATCTGTCAGTTTCCAGTC...

CDS

Download CDS FASTA

921 bp · TkA01G109180|TK1151|CDS

CATACTAACCCACGAAGCTATCCCCCCACAAAACCCCTATCTTCATTTATCCCTTCACTTATCAGTCATCACATCTACACCTTAAAATCATACTCCAACAATCCACACACAAGGTCACCAAACGCAACAATGGCTTCCTCATCTGCTTCGGCAGCTCTTCTTTCTTCTCCAAATCCTAGATTATCCACCTCCATTTCTCCCAAATCCAAGCTCTCTCAAACCCTAGCATTCTCCAGCTCCCCATCTGTCAGTTTCCAGTC...

Protein

Download Protein FASTA

306 aa · TkA01G109180|TK1151|PROTEIN

HTNPRSYPPTKPLSSFIPSLISHHIYTLKSYSNNPHTRSPNATMASSSASAALLSSPNPRLSTSISPKSKLSQTLAFSSSPSVSFQSKSLRSSLSLRPSTSRRNGFVVRAGLPLVGNVAPDFEAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHAEFEKINTEILGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDVTKSISKAFNVLIEDQGIALRGLFIIDKEGVIQHSTINNLAIGRSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G109180`
TK1151 ID	TkA01G109180
OH-1004 ID	LXL04_004813
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 85.948 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G109180

Location Chr01:27701886-27703573 (-)

Description Similar to At5g06290: 2-Cys peroxiredoxin BAS1-like, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11630`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release
`At5g06290`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0537700`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	Rice NTRC is a high-efficiency redox system for chloroplast protection against oxidative damage.2006 · DOI: 10.1105/tpc.106.041541

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004813 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0033554 cellular response to stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010319 stromule Cellular Component

KEGG gene cross-reference

ath:AT3G11630

ath:AT5G06290

dosa:Os02g0537700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · TkA01G109180 · TK1151

Mitochondrion0.032

Rank 2 · TkA01G109180 · TK1151

Cytoplasm0.022

Rank 3 · TkA01G109180 · TK1151

Nucleus0.016

Rank 4 · TkA01G109180 · TK1151

Peroxisome0.013

Rank 5 · TkA01G109180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00578AhpC-TSA115-248 aa

PF08534Redoxin115-251 aa

PF104171-cysPrx_C269-303 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G109180	`PF00578`	AhpC-TSA	115	248	1.6e-40	138.6
TkA01G109180	`PF08534`	Redoxin	115	251	5.5e-13	49.7
TkA01G109180	`PF10417`	1-cysPrx_C	269	303	2.1e-11	44.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96291`	Arabidopsis thaliana	sp\|Q96291\|BAS1A_ARATH 2-Cys peroxiredoxin BAS1, chloroplastic	76.900%	Swiss-Prot	High
`Q9C5R8`	Arabidopsis thaliana	sp\|Q9C5R8\|BAS1B_ARATH 2-Cys peroxiredoxin BAS1-like, chloroplastic	83.400%	Swiss-Prot	High
`Q6ER94`	Oryza sativa subsp. japonica	sp\|Q6ER94\|BAS1_ORYSJ 2-Cys peroxiredoxin BAS1, chloroplastic	86.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card