TkA01G105040 | RubberDandelionOmics

Gene overview

TkA01G105040

Reference: TK1151 Chr: Chr01 Coordinates: 26658684-26660487 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1237 bp · TkA01G105040|TK1151|cDNA

TTGAAATCGCAAAGAAACGTGGTCTCCTAGTTGCCCTTCAACAAGTGACCATACCCTATCCTCATCTCTTACTTAAAACACATTCTCCTACACACATATATTTCCCTTGAGCAAAATAAACCTTAAAACAACACAAATTTTCAAGAATAATCTAAGACCCTTCAAGTTTTATTTTGAAGAGAAGAGAGGAGGCCATTAATAGAAATGGCTCAAGCAATGTTGTTGACATCTAACTCCATACTTTCCGGCCAACCATTGCT...

CDS

Download CDS FASTA

789 bp · TkA01G105040|TK1151|CDS

ATGGCTCAAGCAATGTTGTTGACATCTAACTCCATACTTTCCGGCCAACCATTGCTTCAATCACTTAAACCCAAGCCTTTAGCCTATCACTTACTCCCACGCAACCTTCCACACTTGTCTCGTCCCACAAAGTTTACAGGCCCGATTGCTCTCTTTAAATCCAAGGCCAAAGCTCCGGTCAAGAAGGTCGTAGCACCAAAGCCGAAAGTTGAAGATGGTATTTTTGGTACATCAGGAGGCATTGGATTCACAAAGCAAAA...

Protein

Download Protein FASTA

262 aa · TkA01G105040|TK1151|PROTEIN

MAQAMLLTSNSILSGQPLLQSLKPKPLAYHLLPRNLPHLSRPTKFTGPIALFKSKAKAPVKKVVAPKPKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEGLTGKGILQQLNLETGIPIYEAEPLLLFFILFTLLGAIGALGDRGRFVDEPTTGLDKAVIAPGKGIRGALGLSEGGPLFGFTKSNELFVGRLAQLGIAFSLIGEIITGKGALAQLNIETGIPISDIEPLVLFNVAFFFIAALNPGTGKFVTDDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G105040`
TK1151 ID	TkA01G105040
OH-1004 ID	LXL04_004825
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G105040

Location Chr01:26658684-26660487 (-)

Description Similar to PSBS: Photosystem II 22 kDa protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g44575`	Plays an important role in non-photochemical quenching (NPQ), a process maintains the balance between dissipation and utilization of light energy to minimize generation of oxidizing molecules, thereby protecting the plant against photo-oxidative damage.	A pigment-binding protein essential for regulation of photosynthetic light harvesting.2000 · DOI: 10.1038/35000131 Genetic characterization of a flap1 null mutation in Arabidopsis npq4 and pgr5 plants suggests that the regulatory role of FLAP1 involves the control of proton homeostasis in chloroplasts.2019 · DOI: 10.1007/s11120-018-0575-z Arabidopsis mutants lacking DLDG1 and non-photochemical quenching-related proteins reveal the regulatory role of DLDG1 in chloroplast pH homeostasis.2023 · DOI: 10.1002/1873-3468.14687

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WXD9`	Involved in high light-mediated energy-dependent nonphotochemical quenching (NPQ, qE) and thermal dissipation (TD) thus regulating energy conversion in photosystem II and protecting from photoinhibition.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004825 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009644 response to high light intensity Biological Process

GO:0010027 thylakoid membrane organization Biological Process

GO:0010196 nonphotochemical quenching Biological Process

GO:0015979 photosynthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009517 PSII associated light-harvesting complex II Cellular Component

GO:0009523 photosystem II Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G44575

dosa:Os01g0869800

nta:107778533

osa:4324933

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.986

Rank 1 · TkA01G105040 · TK1151

Mitochondrion0.020

Rank 2 · TkA01G105040 · TK1151

Nucleus0.011

Rank 3 · TkA01G105040 · TK1151

Cytoplasm0.011

Rank 4 · TkA01G105040 · TK1151

Cell membrane0.008

Rank 5 · TkA01G105040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31213HliA78-115 aa

PF00504Chloroa_b-bind83-206 aa

PF00504Chloroa_b-bind175-250 aa

PF31213HliA184-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G105040	`PF31213`	HliA	78	115	9.4e-13	48.6
TkA01G105040	`PF00504`	Chloroa_b-bind	83	206	4.1e-10	41.1
TkA01G105040	`PF00504`	Chloroa_b-bind	175	250	4.1e-10	41.1
TkA01G105040	`PF31213`	HliA	184	220	9.4e-13	48.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XF91`	Arabidopsis thaliana	sp\|Q9XF91\|PSBS_ARATH Photosystem II 22 kDa protein, chloroplastic	76.200%	Swiss-Prot	High
`A2WXD9`	Oryza sativa subsp. indica	sp\|A2WXD9\|PSBS1_ORYSI Photosystem II 22 kDa protein 1, chloroplastic	76.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card