TkA01G104470 | RubberDandelionOmics

Gene overview

TkA01G104470

Reference: TK1151 Chr: Chr01 Coordinates: 26512338-26517771 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2237 bp · TkA01G104470|TK1151|cDNA

GAGAGACATTGTTCAATATTCAAAGTAAAAGAAACGCGCAAAGCATGCTTACTAACCTGCCGGTTCCATTTAACTGTTGGACTGAGTTTGTTCTCACGTTGCTACAAATCGACGCAATCTTCCTTTGCACAAATCGATCACAGCTGTGTTCTTCGGTTCTTCCTCCATCATCAGCGCCGAGAGACCTCCCACGACCTTCACAGCTTCAGGGATTTCACGGCGACCTCCCACGACCTTCACAGCTTCAGGGATTTCACGGC...

CDS

Download CDS FASTA

1110 bp · TkA01G104470|TK1151|CDS

ATGTTCATTGCAAACGATGCAACAGTCAAAGGAGGCACATACTACCCCATTACTGTCAAAAAACATCTCAGAGCTCAAGAAATCGCATCTAAATGCAGACTACCATGCATATACCTTGTCGACAGTGGTGGTGCTTTCCTCCCAAAACAGGCAGAAGTTTTCCCTGACAAAGAAAATTTCGGTAGAGTATTTTACAACCAAGCAATCATGTCTTCAGAAGGTATTCCCCAAATTGCCCTCGTATTAGGCTCTTGCACAGC...

Protein

Download Protein FASTA

369 aa · TkA01G104470|TK1151|PROTEIN

MFIANDATVKGGTYYPITVKKHLRAQEIASKCRLPCIYLVDSGGAFLPKQAEVFPDKENFGRVFYNQAIMSSEGIPQIALVLGSCTAGGAYIPAMADESVMVKGNGTIFLAGPPLVKAAIGEEVSSEDLGGADVHCKVSGVSDYFAQDEIHALSIGRNIVKNLHMAGNEGHFSNLQGMVSDYKEPLYDVKELQSIAPTDLKQSFDIRSLISRVVDGSEFDEFKQLYGTGIGRILGQPVGIIGNNGVLFHESALKGAHFVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G104470`
TK1151 ID	TkA01G104470
OH-1004 ID	LXL04_038401
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	85.900
Protein coverage (%)	TK1151 96.206 / OH-1004 69.007 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G104470

Location Chr01:26512338-26517771 (+)

Description Similar to MCCB: Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34030`	Carboxyltransferase subunit of the 3-methylcrotonyl-CoA carboxylase, an enzyme that catalyzes the conversion of 3-methylcrotonyl-CoA to 3-methylglutaconyl-CoA, a critical step for leucine and isovaleric acid catabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038401 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006552 L-leucine catabolic process Biological Process

GO:0007563 regulation of eclosion Biological Process

GO:0015936 coenzyme A metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:1905202 methylcrotonoyl-CoA carboxylase complex Cellular Component

GO:0004485 methylcrotonoyl-CoA carboxylase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0050897 cobalt ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G34030

cel:CELE_F02A9.10

dme:Dmel_CG3267

mmu:78038

rno:361884

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.550

Rank 1 · TkA01G104470 · TK1151

Nucleus0.163

Rank 2 · TkA01G104470 · TK1151

Mitochondrion0.147

Rank 3 · TkA01G104470 · TK1151

Peroxisome0.135

Rank 4 · TkA01G104470 · TK1151

Endoplasmic reticulum0.079

Rank 5 · TkA01G104470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01039Carboxyl_trans2-305 aa

PF03255ACCA12-103 aa

PF11519DUF3222115-149 aa

PF03255ACCA228-243 aa

PF03255ACCA286-305 aa

PF01039Carboxyl_trans305-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G104470	`PF01039`	Carboxyl_trans	2	305	1e-98	331.9
TkA01G104470	`PF03255`	ACCA	12	103	1.9e-07	31.3
TkA01G104470	`PF11519`	DUF3222	115	149	0.14	12.9
TkA01G104470	`PF03255`	ACCA	228	243	1.9e-07	31.3
TkA01G104470	`PF03255`	ACCA	286	305	1.9e-07	31.3
TkA01G104470	`PF01039`	Carboxyl_trans	305	354	1e-98	331.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDD8`	Arabidopsis thaliana	sp\|Q9LDD8\|MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial	68.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card