Gene Card
Gene overview
cDNA / CDS / Protein Sequences
cDNA
No cDNA sequence is available for this reference.
1527 bp · TkA01G100770|TK1151|CDS
ATGTTTGGGTGCAGAAGTTTGCTAAAGCAAATTAGAAAGAGGAAGAGGAAGAGAAGAATACACCACAAACGTATTCCCAAAAACACCAAACAAAACCCTCGTTTAACAGAACAACAACAGCAAGATTTCGCTACAGATGACGGTTTCAGCTTAAAGGGATCTTCCCCATCACAGAATTACGGAGTCCAACCATTGGGGAACTTTTACCTCAGCTCATCTCCTCACAACTCAAGAAACACAGGCTTAGGTAACATCCAAAC...
Protein
Download Protein FASTA508 aa · TkA01G100770|TK1151|PROTEIN
MFGCRSLLKQIRKRKRKRRIHHKRIPKNTKQNPRLTEQQQQDFATDDGFSLKGSSPSQNYGVQPLGNFYLSSSPHNSRNTGLGNIQTLTDELVLDILGFLRGTDLGILSTVSKSFYVFSNHEPLWRNLVLDNCGIDNGFLFKGSWKSTFVAAHHPSFDVSKIGSLGFKVKDFYSDYLFQSWLCANLELKHEWLSRDNIIRRKGISIEEFVTNFEEPNKPVLLEGCLDNWPAIKKWDKDYLIKTCNNTRFSIGPVQMNLQD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G100770 |
|---|---|
| TK1151 ID | TkA01G100770 |
| OH-1004 ID | LXL04_004867 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G100770 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:25499752-25504906 (+) | |||||||||
| Description | Similar to At5g06550: F-box protein At5g06550 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0006909 phagocytosis Biological Process GO:0008380 RNA splicing Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0010030 positive regulation of seed germination Biological Process GO:0010099 regulation of photomorphogenesis Biological Process GO:0010114 response to red light Biological Process GO:0010476 gibberellin mediated signaling pathway Biological Process GO:0018395 peptidyl-lysine hydroxylation to 5-hydroxy-L-lysine Biological Process GO:0030154 cell differentiation Biological Process GO:0035212 cell competition in a multicellular organism Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G78280 ath:AT5G06550 dme:Dmel_CG5383 dre:266962 hmg:100209631 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02043Bac_chlorC48-60 aaPF07883Cupin_273-81 aaPF00646F-box87-126 aaPF12937F-box-like90-130 aaPF13621Cupin_8208-426 aaPF02373JmjC315-426 aaPF07883Cupin_2320-344 aaPF00190Cupin_1321-423 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G100770 | PF02043 | Bac_chlorC | 48 | 60 | 0.07 | 13.9 |
| TkA01G100770 | PF07883 | Cupin_2 | 73 | 81 | 0.021 | 15.2 |
| TkA01G100770 | PF00646 | F-box | 87 | 126 | 0.0003 | 21.3 |
| TkA01G100770 | PF12937 | F-box-like | 90 | 130 | 4.2e-07 | 30.3 |
| TkA01G100770 | PF13621 | Cupin_8 | 208 | 426 | 9e-27 | 95.3 |
| TkA01G100770 | PF02373 | JmjC | 315 | 426 | 1e-15 | 58.9 |
| TkA01G100770 | PF07883 | Cupin_2 | 320 | 344 | 0.021 | 15.2 |
| TkA01G100770 | PF00190 | Cupin_1 | 321 | 423 | 0.13 | 12.6 |
| TkA01G100770 | PF00646 | F-box | 337 | 347 | 0.0003 | 21.3 |
| TkA01G100770 | PF08007 | JmjC_2 | 341 | 350 | 0.052 | 13.8 |
| TkA01G100770 | PF08007 | JmjC_2 | 391 | 426 | 0.052 | 13.8 |
| TkA01G100770 | PF02043 | Bac_chlorC | 393 | 469 | 0.07 | 13.9 |
| TkA01G100770 | PF07883 | Cupin_2 | 394 | 419 | 0.021 | 15.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.