TkA01G099120 | RubberDandelionOmics

Gene overview

TkA01G099120

Reference: TK1151 Chr: Chr01 Coordinates: 25090363-25098251 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2128 bp · TkA01G099120|TK1151|cDNA

AAAAAACATTAATTGTATGCTAGGCAGATTATTTTTGCCGGTAGCGCGAGGCCTTTTTTTTCTCTCAGTCTCACAAATATCACCAATTCCTGCCGATCGTTGCAGATAAAGAATCTTTATTCGAAAATTCCCCCAAATAAAGATTTATCCTTTTGCTTCATCTCGTTGCCCGAAAAGGGTACACACCGTTACCTCTCTTCCCTCTCAAAATTTCACCAATTTCTCATATGATTTTGGTTCATAGTGTCCATACCCATATC...

CDS

Download CDS FASTA

5106 bp · TkA01G099120|TK1151|CDS

ATGGAGTGGGTCCGCAGGCTCAAGCGATCCCACAAACTCCACTTCATCGCTTTTCAGGAATCGCAATTTACTGACTCCTCAAAAATTCTCTTCGACAATTACTGGGATAGATCTGTTTTTGACTTCGATTTTGTTGATGCCAATGGTCGATCAGGAGGTCTTTACTGTATATGGGACCCCTCCATTTTTAAGAAAAAACAGGTGTTCAAATCCCAATTCTCCTTGATTATTGTGGGTTCTATGCAAGGTTTGACTGAGGA...

Protein

Download Protein FASTA

1701 aa · TkA01G099120|TK1151|PROTEIN

MEWVRRLKRSHKLHFIAFQESQFTDSSKILFDNYWDRSVFDFDFVDANGRSGGLYCIWDPSIFKKKQVFKSQFSLIIVGSMQGLTEDLIIANIYAPHCQTLKNDLWDNLVSIINLLNGPWILMGDFNDVRTPEERMNSRFCERGAKSFNSFITRAGLTEYSMGGRKFTYMTDGGEKLSKIDRMLINDNFLSRWPNASLTALPREFSDHCPLVLSTSFLDFGPSPFRFFNSWLSEPDFHQVVFNTAVTFDFEGPFDKLLPC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G099120`
TK1151 ID	TkA01G099120
OH-1004 ID	LXL04_014780
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.600
Protein coverage (%)	TK1151 63.845 / OH-1004 43.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G099120

Location Chr01:25090363-25098251 (-)

Description Similar to Transposon TX1 uncharacterized 149 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35220`	Membrane-associated and ATP-independent metalloprotease required for development of both thylakoid grana and well-organized lamellae in chloroplast.	EGY1 encodes a membrane-associated and ATP-independent metalloprotease that is required for chloroplast development.2005 · DOI: 10.1111/j.1365-313x.2004.02308.x EGY1 plays a role in regulation of endodermal plastid size and number that are involved in ethylene-dependent gravitropism of light-grown Arabidopsis hypocotyls.2008 · DOI: 10.1007/s11103-007-9273-5 Arabidopsis plastid AMOS1/EGY1 integrates abscisic acid signaling to regulate global gene expression response to ammonium stress.2012 · DOI: 10.1104/pp.112.206508
`At5g35210`	Membrane-bound transcription factor required for the plastid-to-nucleus retrograde signaling.	No verified direct reference in this release
`UniProt: P92555`	Uncharacterized mitochondrial protein AtMg01250.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0792400`	Probable membrane-associated metalloprotease that may be involved in chloroplast development.	No verified direct reference in this release
`UniProt: B8AD72`	Probable membrane-associated metalloprotease that may be involved in chloroplast development.	No verified direct reference in this release
`Os01g0142100`	Probable membrane-associated metalloprotease that may be involved in chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014780 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031297 replication fork processing Biological Process

GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process

GO:0032197 retrotransposition Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:2000001 regulation of DNA damage checkpoint Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

hsa:55159

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.889

Rank 1 · TkA01G099120 · TK1151

Mitochondrion0.058

Rank 2 · TkA01G099120 · TK1151

Cytoplasm0.058

Rank 3 · TkA01G099120 · TK1151

Cell membrane0.054

Rank 4 · TkA01G099120 · TK1151

Peroxisome0.048

Rank 5 · TkA01G099120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372Exo_endo_phos10-208 aa

PF13966zf-RVT58-99 aa

PF14529Exo_endo_phos_289-211 aa

PF02163Peptidase_M50462-471 aa

PF00078RVT_1492-741 aa

PF13966zf-RVT975-1028 aa

PF27677EGY3_M1298-1382 aa

PF02163Peptidase_M501454-1613 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G099120	`PF03372`	Exo_endo_phos	10	208	9.2e-07	29.6
TkA01G099120	`PF13966`	zf-RVT	58	99	0.053	14.9
TkA01G099120	`PF14529`	Exo_endo_phos_2	89	211	0.00014	22.4
TkA01G099120	`PF02163`	Peptidase_M50	462	471	1.4e-16	61.3
TkA01G099120	`PF00078`	RVT_1	492	741	1.1e-29	104.5
TkA01G099120	`PF13966`	zf-RVT	975	1028	0.053	14.9
TkA01G099120	`PF27677`	EGY3_M	1298	1382	4e-25	88.2
TkA01G099120	`PF02163`	Peptidase_M50	1454	1613	1.4e-16	61.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949Y5`	Arabidopsis thaliana	sp\|Q949Y5\|EGY1_ARATH Probable zinc metalloprotease EGY1, chloroplastic	69.100%	Swiss-Prot	High
`F4JYC8`	Arabidopsis thaliana	sp\|F4JYC8\|PTM_ARATH DDT domain-containing protein PTM	81.800%	Swiss-Prot	Low
`P92555`	Arabidopsis thaliana	sp\|P92555\|M1250_ARATH Uncharacterized mitochondrial protein AtMg01250	43.300%	Swiss-Prot	Low
`Q852K0`	Oryza sativa subsp. japonica	sp\|Q852K0\|EGY1_ORYSJ Probable zinc metalloprotease EGY1, chloroplastic	77.400%	Swiss-Prot	High
`B8AD72`	Oryza sativa subsp. indica	sp\|B8AD72\|EGY2_ORYSI Probable zinc metalloprotease EGY2, chloroplastic	31.400%	Swiss-Prot	Medium
`Q0JQS5`	Oryza sativa subsp. japonica	sp\|Q0JQS5\|EGY2_ORYSJ Probable zinc metalloprotease EGY2, chloroplastic	31.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card