TkA01G096770 | RubberDandelionOmics

Gene overview

TkA01G096770

Reference: TK1151 Chr: Chr01 Coordinates: 24456272-24459580 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

976 bp · TkA01G096770|TK1151|cDNA

CTTAATTATAATAACTTCTTTCTTTCTCGATGGCTTCGCTGTGCTTCTATTCTGCTGGAAATCTCCATTACAACAATTCTCTCAACGGAACTAGACCTCTTCACATATGTAAGCAAATACGTTCCTCACAATCCACAATTATCGCCGTAATTAATTCAAATGAACCCAACGTTAGACGATCAGCAAACTATGAGCCATCTATATGGTCATTTGATCATGTTCAATCACTCTCTAACAAATACAAGGGAGAAGATTACGTG...

CDS

Download CDS FASTA

1770 bp · TkA01G096770|TK1151|CDS

ATGGCTTCGCTGTGCTTCTATTCTGCTGGAAATCTCCATTACAACAATTCTCTCAACGGAACTAGACCTCTTCACATATGTAAGCAAATACGTTCCTCACAATCCACAATTATCGCCGTAATTAATTCAAATGAACCCAACGTTAGACGATCAGCAAACTATGAGCCATCTATATGGTCATTTGATCATGTTCAATCACTCTCTAACAAATACAAGGGAGAAGATTACGTGGCAAGAGCAAATACTTTAAGGGAAGTAGT...

Protein

Download Protein FASTA

589 aa · TkA01G096770|TK1151|PROTEIN

MASLCFYSAGNLHYNNSLNGTRPLHICKQIRSSQSTIIAVINSNEPNVRRSANYEPSIWSFDHVQSLSNKYKGEDYVARANTLREVVKTMIHNVGNPLSALELVDDMQRLGISYHFEDEINEVLDMIYYKYFLTDNKWSGMGLNLKALGFRLLRQHGYQVPQGIFGNFKDKTQDLNPNLLEDVVGMLNLYEASYHSFEGEDILDEVRDCTTEYLQENLDKFDGSTISLLVSHALELPLHWRVPRVEAKWFIEVYEKSSGM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G096770`
TK1151 ID	TkA01G096770
OH-1004 ID	LXL04_004922
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G096770`
Location	Chr01:24456272-24459580 (+)
Description	Similar to QH5: R-linalool synthase QH5, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_004922` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009611 response to wounding Biological Process GO:0016102 diterpenoid biosynthetic process Biological Process GO:0033383 geranyl diphosphate metabolic process Biological Process GO:0046246 terpene biosynthetic process Biological Process GO:0051762 sesquiterpene biosynthetic process Biological Process GO:0009507 chloroplast Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function GO:0010334 sesquiterpene synthase activity Molecular Function GO:0034008 R-linalool synthase activity Molecular Function GO:0050550 pinene synthase activity Molecular Function
KEGG gene cross-reference	ag:AAF13356 ag:AAF13357 ag:AAK58723 rcu:8261702 vvi:100232956 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.939

Rank 1 · TkA01G096770 · TK1151

Cytoplasm0.128

Rank 2 · TkA01G096770 · TK1151

Peroxisome0.053

Rank 3 · TkA01G096770 · TK1151

Nucleus0.038

Rank 4 · TkA01G096770 · TK1151

Mitochondrion0.026

Rank 5 · TkA01G096770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14123DUF429034-69 aa

PF01397Terpene_synth59-234 aa

PF08506Cse1111-132 aa

PF03936Terpene_synth_C294-529 aa

PF19086Terpene_syn_C_2331-529 aa

PF08506Cse1464-555 aa

PF14123DUF4290507-548 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G096770	`PF14123`	DUF4290	34	69	0.21	11.8
TkA01G096770	`PF01397`	Terpene_synth	59	234	1.2e-44	153.0
TkA01G096770	`PF08506`	Cse1	111	132	0.11	12.0
TkA01G096770	`PF03936`	Terpene_synth_C	294	529	1.5e-87	293.6
TkA01G096770	`PF19086`	Terpene_syn_C_2	331	529	3.5e-59	200.6
TkA01G096770	`PF08506`	Cse1	464	555	0.11	12.0
TkA01G096770	`PF14123`	DUF4290	507	548	0.21	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card