TkA01G095270 | RubberDandelionOmics

Gene overview

TkA01G095270

Reference: TK1151 Chr: Chr01 Coordinates: 24083412-24089909 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1267 bp · TkA01G095270|TK1151|cDNA

AAAAACTATCAAACAAAAATGTATTATCGTTATGAAACCGGTATAAGTTATTTTAAGCATCTATCTGATTCCCTTTCATTAGCCCTCAACAACAGAAGCATCCGACTGGTCGCCCGCTTGCTCTCGTCCTCTGTGTGACGCCGGCGCTCGATCCACCGAAAAAGCGCTCCTCCCCAGCCGGCGCTGGGCCTGCTGTCGCCATATATTTGCTGATTCTCGTCTCTCATCGATCGTCTCGTCTTCTCCAATTTCCATCATCG...

CDS

Download CDS FASTA

939 bp · TkA01G095270|TK1151|CDS

ATGAAAGAGCTAGCAACCGAAAAACACACAAAATACATCCTCCAAATCGAAAAAAAAACCGACAACATCGAATCCGCCCTAACCGAACACCTCCGAATAAACGGCGCATACTGGGGCCTAACAACCCTCGACATCCTCAACAACCTCAAAGCCGTCGAACAAGACGCCGTCGTTTCCTGGGTCCTGAGTTGCCAGCACGAATCCGGCGGATTCGGTGGCAACACAGGACACGACCCCCACCTCCTCTACACCCTATCCGC...

Protein

Download Protein FASTA

312 aa · TkA01G095270|TK1151|PROTEIN

MKELATEKHTKYILQIEKKTDNIESALTEHLRINGAYWGLTTLDILNNLKAVEQDAVVSWVLSCQHESGGFGGNTGHDPHLLYTLSAIQILTLFNKIQNLNIPKTSTYISNLQNKDGSFSGDQYGETDTRFSYLAICSLSLLKTLNKINVEKAVEFIVSCRNLDGGFGCTPGAESHAGQIFCCVGALAIVGCLHYVDKDLLGWWLCERQVKSGGLNGRPEKLPDVCYSWWVLSSLIMIDRVGWIDKERLVKFILECQDFE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G095270`
TK1151 ID	TkA01G095270
OH-1004 ID	LXL04_004939
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G095270

Location Chr01:24083412-24089909 (-)

Description Similar to RGTB1: Geranylgeranyl transferase type-2 subunit beta 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g12210`	May catalyze geranylgeranylation of Rab proteins.	Arabidopsis RAB geranylgeranyl transferase beta-subunit mutant is constitutively photomorphogenic, and has shoot growth and gravitropic defects.2010 · DOI: 10.1111/j.1365-313x.2010.04172.x Rab geranylgeranyl transferase β subunit is essential for male fertility and tip growth in Arabidopsis.2015 · DOI: 10.1093/jxb/eru412 Arabidopsis Rab Geranylgeranyltransferases Demonstrate Redundancy and Broad Substrate Specificity in Vitro.2016 · DOI: 10.1074/jbc.m115.673491
`At5g02790`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release
`At5g02780`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release
`At3g55040`	Catalyzes the glutathione-dependent reduction of S-glutathionylquercetin to quercetin.	No verified direct reference in this release
`At3g12070`	May catalyze geranylgeranylation of Rab proteins.	Arabidopsis Rab Geranylgeranyltransferases Demonstrate Redundancy and Broad Substrate Specificity in Vitro.2016 · DOI: 10.1074/jbc.m115.673491

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A1XBB7`	Protein IN2-1 homolog B.	No verified direct reference in this release
`Os03g0283100`	Protein IN2-1 homolog B.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004939 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009960 endosperm development Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010214 seed coat development Biological Process

GO:0010315 auxin export across the plasma membrane Biological Process

GO:0018344 protein geranylgeranylation Biological Process

GO:0048316 seed development Biological Process

GO:0048364 root development Biological Process

GO:0140301 pollen-stigma interaction Biological Process

KEGG gene cross-reference

ath:AT3G12070

ath:AT5G12210

bta:533276

mmu:19352

rno:25533

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.709

Rank 1 · TkA01G095270 · TK1151

Nucleus0.318

Rank 2 · TkA01G095270 · TK1151

Mitochondrion0.084

Rank 3 · TkA01G095270 · TK1151

Endoplasmic reticulum0.074

Rank 4 · TkA01G095270 · TK1151

Golgi apparatus0.071

Rank 5 · TkA01G095270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00432Prenyltrans4-300 aa

PF13249SQHop_cyclase_N44-87 aa

PF13243SQHop_cyclase_C55-74 aa

PF13243SQHop_cyclase_C100-170 aa

PF13249SQHop_cyclase_N104-184 aa

PF13249SQHop_cyclase_N204-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G095270	`PF00432`	Prenyltrans	4	300	8.2e-101	338.1
TkA01G095270	`PF13249`	SQHop_cyclase_N	44	87	0.0012	18.9
TkA01G095270	`PF13243`	SQHop_cyclase_C	55	74	8.1e-05	22.5
TkA01G095270	`PF13243`	SQHop_cyclase_C	100	170	8.1e-05	22.5
TkA01G095270	`PF13249`	SQHop_cyclase_N	104	184	0.0012	18.9
TkA01G095270	`PF13249`	SQHop_cyclase_N	204	217	0.0012	18.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84J75`	Arabidopsis thaliana	sp\|Q84J75\|PG2B1_ARATH Geranylgeranyl transferase type-2 subunit beta 1	73.500%	Swiss-Prot	High
`Q9LZ06`	Arabidopsis thaliana	sp\|Q9LZ06\|GSTL3_ARATH Glutathione S-transferase L3	67.000%	Swiss-Prot	High
`Q6NLB0`	Arabidopsis thaliana	sp\|Q6NLB0\|GSTL1_ARATH Glutathione S-transferase L1	67.100%	Swiss-Prot	High
`Q9M2W2`	Arabidopsis thaliana	sp\|Q9M2W2\|GSTL2_ARATH Glutathione S-transferase L2, chloroplastic	59.800%	Swiss-Prot	High
`Q9LHL5`	Arabidopsis thaliana	sp\|Q9LHL5\|PGTB2_ARATH Geranylgeranyl transferase type-2 subunit beta 2	67.000%	Swiss-Prot	High
`A1XBB7`	Oryza sativa subsp. indica	sp\|A1XBB7\|IN21B_ORYSI Protein IN2-1 homolog B	64.600%	Swiss-Prot	High
`Q8H8U5`	Oryza sativa subsp. japonica	sp\|Q8H8U5\|IN21B_ORYSJ Protein IN2-1 homolog B	64.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card