Gene Card
Gene overview
cDNA / CDS / Protein Sequences
939 bp · LXL04_004939|LXL04_004939|OH1004|cDNA
ATGAAAGAGCTAGCAACCGAAAAACACACAAAATACATCCTCcaaatcgaaaaaaaaaccgacAACATCGAATCCGCCCTAACCGAACACCTCCGAATAAACGGCGCATACTGGGGCCTAACAACCCTCGACATCCTCAACAACCTCAAAGCCGTCGAACAAGACGCCGTCGTTTCTTGGGTCCTGAGTTGCCAGCACGAATCCGGCGGATTCGGTGGCAACACAGGACACGACCCCCACCTCCTCTACACCCTATCCGC...
939 bp · LXL04_004939|LXL04_004939|OH1004|CDS
ATGAAAGAGCTAGCAACCGAAAAACACACAAAATACATCCTCCAAATCGAAAAAAAAACCGACAACATCGAATCCGCCCTAACCGAACACCTCCGAATAAACGGCGCATACTGGGGCCTAACAACCCTCGACATCCTCAACAACCTCAAAGCCGTCGAACAAGACGCCGTCGTTTCTTGGGTCCTGAGTTGCCAGCACGAATCCGGCGGATTCGGTGGCAACACAGGACACGACCCCCACCTCCTCTACACCCTATCCGC...
Protein
Download Protein FASTA312 aa · LXL04_004939|LXL04_004939|OH1004|PROTEIN
MKELATEKHTKYILQIEKKTDNIESALTEHLRINGAYWGLTTLDILNNLKAVEQDAVVSWVLSCQHESGGFGGNTGHDPHLLYTLSAIQILTLFNKIQNLNIPKTSTYISNLQNKDGSFSGDQYGETDTRFSYLAICSLSLLKTLNKINVEKAVEFIVSCRNLDGGFGCTPGAESHAGQIFCCVGALAIVGCLHYVDKDLLGWWLCERQVKSGGLNGRPEKLPDVCYSWWVLSSLIMIDRVGWIDKERLVKFILECQDFE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_004939 |
|---|---|
| TK1151 ID | TkA01G095270 |
| OH-1004 ID | LXL04_004939 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_004939 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:150602539-150603477 (+) | |||||||||
| Description | Similar to RGTB1: Geranylgeranyl transferase type-2 subunit beta 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0009553 embryo sac development Biological Process GO:0009555 pollen development Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009960 endosperm development Biological Process GO:0010183 pollen tube guidance Biological Process GO:0010214 seed coat development Biological Process GO:0010315 auxin export across the plasma membrane Biological Process GO:0018344 protein geranylgeranylation Biological Process GO:0048316 seed development Biological Process GO:0048364 root development Biological Process GO:0140301 pollen-stigma interaction Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G12070 ath:AT5G12210 bta:533276 mmu:19352 rno:25533 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00432.28Prenyltrans4-300 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_004939 | PF00432.28 | Prenyltrans | 4 | 300 | 7.2e-101 | 338.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.