TkA01G093230 | RubberDandelionOmics

Gene overview

TkA01G093230

Reference: TK1151 Chr: Chr01 Coordinates: 23581252-23582408 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

524 bp · TkA01G093230|TK1151|cDNA

CTTTGCATGGTCTGGGTATGAATTCGGCGAAAAAATCATGCTTCCATAAGAATAAAGCAGACTTATGCATCAAGCTTTCAATGGGGGTTTTTGTGTTAATATTATGCAGTTACGTGACTTTACCTCTTTACGCTTTAGTGACACAAATGGGTTCGACCATGAAGCCCACAATATTTAACGATAAAGTGGTGAAATCGCTACACAAATGGCACCAAAGAGCGAAAAAGCAAGTGAAACAAAACCGCATGTTAGATACTACA...

CDS

Download CDS FASTA

507 bp · TkA01G093230|TK1151|CDS

ATGAATTCGGCGAAAAAATCATGCTTCCATAAGAATAAAGCAGACTTATGCATCAAGCTTTCAATGGGGGTTTTTGTGTTAATATTATGCAGTTACGTGACTTTACCTCTTTACGCTTTAGTGACACAAATGGGTTCGACCATGAAGCCCACAATATTTAACGATAAAGTGGTGAAATCGCTACACAAATGGCACCAAAGAGCGAAAAAGCAAGTGAAACAAAACCGCATGTTAGATACTACAACCCCGGGGTCTTCTAG...

Protein

Download Protein FASTA

169 aa · TkA01G093230|TK1151|PROTEIN

MNSAKKSCFHKNKADLCIKLSMGVFVLILCSYVTLPLYALVTQMGSTMKPTIFNDKVVKSLHKWHQRAKKQVKQNRMLDTTTPGSSRPSTPSHWTTRSTSFNESTQRVSEFHDPIYEHEGRVGSLEVHKSVVEEANDGRVVVDQYKIDVDYEDFSFDNYIEGCEIGAKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G093230`
TK1151 ID	TkA01G093230
OH-1004 ID	LXL04_004963
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 97.041 / OH-1004 30.147 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G093230

Location Chr01:23581252-23582408 (-)

Description Similar to MLO6: MLO-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61560`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At1g11310`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g39200`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At5g65970`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g33670`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004963 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009620 response to fungus Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G11310

ath:AT1G61560

ath:AT2G17480

ath:AT2G33670

ath:AT2G39200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.617

Rank 1 · TkA01G093230 · TK1151

Cytoplasm0.188

Rank 2 · TkA01G093230 · TK1151

Endoplasmic reticulum0.145

Rank 3 · TkA01G093230 · TK1151

Nucleus0.136

Rank 4 · TkA01G093230 · TK1151

Lysosome / Vacuole0.114

Rank 5 · TkA01G093230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094Mlo4-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G093230	`PF03094`	Mlo	4	96	1.1e-34	120.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94KB7`	Arabidopsis thaliana	sp\|Q94KB7\|MLO6_ARATH MLO-like protein 6	47.600%	Swiss-Prot	Medium
`Q9SXB6`	Arabidopsis thaliana	sp\|Q9SXB6\|MLO2_ARATH MLO-like protein 2	60.900%	Swiss-Prot	Medium
`O80961`	Arabidopsis thaliana	sp\|O80961\|MLO12_ARATH MLO-like protein 12	58.000%	Swiss-Prot	Medium
`Q9FKY5`	Arabidopsis thaliana	sp\|Q9FKY5\|MLO10_ARATH MLO-like protein 10	54.400%	Swiss-Prot	Low
`O22815`	Arabidopsis thaliana	sp\|O22815\|MLO5_ARATH MLO-like protein 5	50.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card