LXL04_004963 | RubberDandelionOmics

Gene overview

LXL04_004963

Reference: OH-1004 Chr: Chr01 Coordinates: 151077370-151080981 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1635 bp · LXL04_004963|LXL04_004963|OH1004|cDNA

aTGGTGGAAGGGATTCGAACATTAGAGAGGACACCAACATGGGCTGTGGCTTCTGTGTGTTTAGTCCTAGTTACCTTATCGATTCTCATCGAACACTTTATTCATTTAATCGGAAAGTGGTTGAAAAAGAAGAATAAGAAGACGTTATTTGAAGCACTCGAAAAGATCAAATCGGAACTTATGTTACTAGGATTCATCTCATTGCTGCTCACAGTCGGGCAGTCTTTTATAACGAATATCTGCATATCAGAATCTCTTGG...

CDS

Download CDS FASTA

1635 bp · LXL04_004963|LXL04_004963|OH1004|CDS

ATGGTGGAAGGGATTCGAACATTAGAGAGGACACCAACATGGGCTGTGGCTTCTGTGTGTTTAGTCCTAGTTACCTTATCGATTCTCATCGAACACTTTATTCATTTAATCGGAAAGTGGTTGAAAAAGAAGAATAAGAAGACGTTATTTGAAGCACTCGAAAAGATCAAATCGGAACTTATGTTACTAGGATTCATCTCATTGCTGCTCACAGTCGGGCAGTCTTTTATAACGAATATCTGCATATCAGAATCTCTTGG...

Protein

Download Protein FASTA

544 aa · LXL04_004963|LXL04_004963|OH1004|PROTEIN

MVEGIRTLERTPTWAVASVCLVLVTLSILIEHFIHLIGKWLKKKNKKTLFEALEKIKSELMLLGFISLLLTVGQSFITNICISESLGDTWLPCSKKDIDKEDADHHVTNEEILSRRFLMGATSGDKCKAQGKVPFLSSDALYELHMFIFSLALYHVICSIITLAFGRAKMKEWKAWEMETQTIEYQYKHDPERFRLARDTTFGQRHLSIWSRSPILVWMVGFIRQFGMSVPKVDYMTLRHGFIMAHLAPNNQANFNFQKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004963`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004963

Location Chr01:151077370-151080981 (+)

Description Similar to MLO6: MLO-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61560`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At1g11310`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g39200`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g17480`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release
`At2g33670`	May be involved in modulation of pathogen defense and leaf cell death.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004963 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009620 response to fungus Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G11310

ath:AT1G61560

ath:AT2G17480

ath:AT2G33670

ath:AT2G39200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.838

Rank 1 · LXL04_004963 · OH-1004

Cytoplasm0.100

Rank 2 · LXL04_004963 · OH-1004

Endoplasmic reticulum0.098

Rank 3 · LXL04_004963 · OH-1004

Lysosome / Vacuole0.049

Rank 4 · LXL04_004963 · OH-1004

Golgi apparatus0.041

Rank 5 · LXL04_004963 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03094.21Mlo6-472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004963	`PF03094.21`	Mlo	6	472	9.9e-220	730.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94KB7`	Arabidopsis thaliana	MLO-like protein 6	57.038%	Swiss-Prot	strong database homology
`Q9SXB6`	Arabidopsis thaliana	MLO-like protein 2	58.884%	Swiss-Prot	strong database homology
`O80961`	Arabidopsis thaliana	MLO-like protein 12	59.454%	Swiss-Prot	strong database homology
`O22757`	Arabidopsis thaliana	MLO-like protein 8	49.064%	Swiss-Prot	moderate database homology
`O22815`	Arabidopsis thaliana	MLO-like protein 5	49.244%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card