RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G092770
Reference: TK1151 Chr: Chr01 Coordinates: 23460075-23462213 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2047 bp · TkA01G092770|TK1151|cDNA

AAGACAATGATGAAAACCTAATTTTTATCTAATCATTGTGTAGTTGTTCCGGAGTGGAGTTGGCTTCTTTACGCAACCAATCATCATATTATTCCGCTCCCCATACACGCTCTCTCACACACAAACACATTAAACACACAATATCCTGTTTTTCTTTTTCTTCATAATTTGGTGCCTATAAAAAAACTATAATTTCTCACAAATTCTTTACCCATTATCTTTATCGGGTAATCTTCCTTATCACGAGTATTTCTTGAATC...

CDS

Download CDS FASTA

1080 bp · TkA01G092770|TK1151|CDS

ATGGGTAACGTGGGAAGTAATAGTTCTAACGGCCGGCGGAGGCACGGCGGCGGAAGCGGCAGGCGGGGTAGTCATCATACTCACCACCACCAGCAACAGCCGCAGCCGGAAATCCCCAATCGATACGTATACGCCGCCGCAACAGCTTACACTTCCCAATACCCTAACCCTCCTCCTCCATCTCACCCACCCTATTACCAGTACCCAACCGGAGCATTCTACCCACCACCACCACTTCCAGCTGCGCCGTTGCCTCCACC...

Protein

Download Protein FASTA

359 aa · TkA01G092770|TK1151|PROTEIN

MGNVGSNSSNGRRRHGGGSGRRGSHHTHHHQQQPQPEIPNRYVYAAATAYTSQYPNPPPPSHPPYYQYPTGAFYPPPPLPAAPLPPPHNHRIPMETAAGWVGGRYPCTPVMHLPTPYIDHQKAVTIRNDVNLKKETLKIEADEENPGKFLVSFTFDSTVPCSITLYFFAEEGEDCNLKTTKEDSLPPLTVTFEQGLGQKFRQKPGTGIELATYKHTELSEHESTVYPLAVKAEATLTDRNHDSGVTNSQITDAVFENNKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G092770
TK1151 IDTkA01G092770
OH-1004 IDLXL04_004971
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G092770
LocationChr01:23460075-23462213 (+)
DescriptionSimilar to LOG2: Probable E3 ubiquitin-protein ligase LOG2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g09770 Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro). No verified direct reference in this release
At5g03200 Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro). No verified direct reference in this release
At3g53410 Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro). No verified direct reference in this release
At3g06140 Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro). No verified direct reference in this release
At5g19080 Acts as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates (in vitro). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_004971 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009737 response to abscisic acid Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0080144 intracellular amino acid homeostasis Biological Process
GO:0090333 regulation of stomatal closure Biological Process
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004842 ubiquitin-protein transferase activity Molecular Function
GO:0008270 zinc ion binding Molecular Function
GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference
ath:AT3G06140
ath:AT3G09770
ath:AT3G53410
ath:AT5G03200
ath:AT5G19080
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.476
Rank 1 · TkA01G092770 · TK1151
Nucleus0.392
Rank 2 · TkA01G092770 · TK1151
Cell membrane0.170
Rank 3 · TkA01G092770 · TK1151
Lysosome / Vacuole0.110
Rank 4 · TkA01G092770 · TK1151
Endoplasmic reticulum0.098
Rank 5 · TkA01G092770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06495Transformer7-79 aa
PF26192RNF157-like_N130-280 aa
PF14634zf-RING_5300-343 aa
PF14570zf-RING_4300-344 aa
PF13920zf-C3HC4_3301-347 aa
PF13639zf-RING_2302-342 aa
PF13923zf-C3HC4_2302-341 aa
PF17123zf-RING_11302-321 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G092770PF06495Transformer7797.17.4
TkA01G092770PF26192RNF157-like_N1302803.1e-60203.8
TkA01G092770PF14634zf-RING_53003430.04114.6
TkA01G092770PF14570zf-RING_43003449.66.8
TkA01G092770PF13920zf-C3HC4_33013474.6e-1555.9
TkA01G092770PF13639zf-RING_23023426e-0730.3
TkA01G092770PF13923zf-C3HC4_23023410.3811.3
TkA01G092770PF17123zf-RING_113023210.8110.1
TkA01G092770PF14447Prok-RING_43033462.5e-0524.8
TkA01G092770PF00097zf-C3HC43033410.003417.9
TkA01G092770PF24921RING_XB3-XBAT313033461.010.1
TkA01G092770PF03854zf-P113113450.1112.9
TkA01G092770PF17123zf-RING_113383460.8110.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9S752Arabidopsis thalianasp|Q9S752|LOFG2_ARATH Probable E3 ubiquitin-protein ligase LOG263.500%Swiss-ProtHigh
Q9LYW5Arabidopsis thalianasp|Q9LYW5|LUL1_ARATH Probable E3 ubiquitin-protein ligase LUL153.600%Swiss-ProtHigh
Q9LFH6Arabidopsis thalianasp|Q9LFH6|LUL2_ARATH Probable E3 ubiquitin-protein ligase LUL264.900%Swiss-ProtMedium
Q8LA32Arabidopsis thalianasp|Q8LA32|LUL4_ARATH Probable E3 ubiquitin-protein ligase LUL445.800%Swiss-ProtMedium
Q84ME1Arabidopsis thalianasp|Q84ME1|LUL3_ARATH Probable E3 ubiquitin-protein ligase LUL345.500%Swiss-ProtMedium

JBrowse

View in Genome Browser