TkA01G087830 | RubberDandelionOmics

Gene overview

TkA01G087830

Reference: TK1151 Chr: Chr01 Coordinates: 22364561-22365559 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

923 bp · TkA01G087830|TK1151|cDNA

AAAAAAAATCATCTTAAATTCCAATGCAAACGAGTACCACTACTTCTAGCGCCAGTTTTAGCTAGCCACCAAAATCACATGGCTGCTAGAACACTAATACCCTCACCTCCGCTGTCTCTCCTCCCAGGAAGAGGCGCCACCACCACCACCACCACGGTCTCTTGCTTGAAACCCACGACTCGAGTAGGCGGCAAAAGAGTCCTAAGGGTTTATGCAGCAGACGGAGAAGGCGGAAGAGGAGGTGGAGGGAAGCAGAGAGC...

CDS

Download CDS FASTA

765 bp · TkA01G087830|TK1151|CDS

ATGGCTGCTAGAACACTAATACCCTCACCTCCGCTGTCTCTCCTCCCAGGAAGAGGCGCCACCACCACCACCACCACGGTCTCTTGCTTGAAACCCACGACTCGAGTAGGCGGCAAAAGAGTCCTAAGGGTTTATGCAGCAGACGGAGAAGGCGGAAGAGGAGGTGGAGGGAAGCAGAGAGCACCACCAGGAATAGACACCAGAATCCATTGGGAGAACGACGATGACGGATGGGTTGGCGGCAGCACCACCAACTCTGC...

Protein

Download Protein FASTA

254 aa · TkA01G087830|TK1151|PROTEIN

MAARTLIPSPPLSLLPGRGATTTTTTVSCLKPTTRVGGKRVLRVYAADGEGGRGGGGKQRAPPGIDTRIHWENDDDGWVGGSTTNSAPEEDQTNNLLGEKFSELLNNSTDSHYQFLGVPAEADLEEIKAAYRRLSKEYHPDTTSLPLKTASEMFMRLREIYDVLSDSEKRRFYDWTLAQEAASREAEKMKVKLEDPYMKDIENFVSVPDMVDRLGRRNMELSDQAKSALTFDIFVIIFAICCIIYVVYFKEPYY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G087830`
TK1151 ID	TkA01G087830
OH-1004 ID	LXL04_005072
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G087830

Location Chr01:22364561-22365559 (+)

Description Similar to ndhT: NAD(P)H-quinone oxidoreductase subunit T, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g09350`	NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain.	An Src homology 3 domain-like fold protein forms a ferredoxin binding site for the chloroplast NADH dehydrogenase-like complex in Arabidopsis.2011 · DOI: 10.1105/tpc.110.080291

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005072 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0010598 NAD(P)H dehydrogenase complex (plastoquinone) Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0031072 heat shock protein binding Molecular Function

GO:0048038 quinone binding Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

aae:aq_703

ate:Athe_1550

ath:AT4G09350

csc:Csac_1753

hte:Hydth_1877

hth:HTH_1895

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.944

Rank 1 · TkA01G087830 · TK1151

Nucleus0.050

Rank 2 · TkA01G087830 · TK1151

Mitochondrion0.037

Rank 3 · TkA01G087830 · TK1151

Cytoplasm0.021

Rank 4 · TkA01G087830 · TK1151

Cell membrane0.017

Rank 5 · TkA01G087830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19144DUF582619-32 aa

PF00226DnaJ112-174 aa

PF30912TIM141_C115-142 aa

PF30912TIM141_C170-188 aa

PF19144DUF5826226-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G087830	`PF19144`	DUF5826	19	32	0.97	10.3
TkA01G087830	`PF00226`	DnaJ	112	174	8.5e-21	74.5
TkA01G087830	`PF30912`	TIM141_C	115	142	0.016	16.0
TkA01G087830	`PF30912`	TIM141_C	170	188	0.016	16.0
TkA01G087830	`PF19144`	DUF5826	226	246	0.97	10.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMS0`	Arabidopsis thaliana	sp\|Q9SMS0\|NDHT_ARATH NAD(P)H-quinone oxidoreductase subunit T, chloroplastic	64.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card