TkA01G087240 | RubberDandelionOmics

Gene overview

TkA01G087240

Reference: TK1151 Chr: Chr01 Coordinates: 22226983-22228209 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · TkA01G087240|TK1151|cDNA

ATGGTTCCTACTATGGTCCGAGATCTCAGTCCAAGTTCTTTTACCCCTACGGTGGTCGCTATTGGCCCTCTTCACAGCCAAGATGAACATCTGCAAGAATTTGAAGTTCAGAAAACAGCTTATTTCCATAAGTGGTTGCATCGTTTGGGTATTAATGAAGGAATCAAGGCATGTTATGCAGGGGTAATGACCTACACCGATTCTGAGCTAGCAAAGATGATGGTAATAGATGCGTGTTTCATACTTGAGTTCATTCAGAG...

CDS

Download CDS FASTA

1143 bp · TkA01G087240|TK1151|CDS

ATGGTTCCTACTATGGTCCGAGATCTCAGTCCAAGTTCTTTTACCCCTACGGTGGTCGCTATTGGCCCTCTTCACAGCCAAGATGAACATCTGCAAGAATTTGAAGTTCAGAAAACAGCTTATTTCCATAAGTGGTTGCATCGTTTGGGTATTAATGAAGGAATCAAGGCATGTTATGCAGGGGTAATGACCTACACCGATTCTGAGCTAGCAAAGATGATGGTAATAGATGCGTGTTTCATACTTGAGTTCATTCAGAG...

Protein

Download Protein FASTA

380 aa · TkA01G087240|TK1151|PROTEIN

MVPTMVRDLSPSSFTPTVVAIGPLHSQDEHLQEFEVQKTAYFHKWLHRLGINEGIKACYAGVMTYTDSELAKMMVIDACFILEFIQSHFILSGTLSGPNILIAQSIYLDILLIENQIPFFVLKIIFDCTILASGPMTDGSSLAKYIEVLVSGYYFIEEHVVEPDALSPDPDHILGFLHKYFRPAEPMPPTSQLSTKRHTAMELDRAGMKFKPINENKNWVLDMKMAIPQFSWFQRPTMWMPKLKIHDQSELILRNLIVYE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G087240`
TK1151 ID	TkA01G087240
OH-1004 ID	LXL04_038766
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 98.684 / OH-1004 71.327 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G087240

Location Chr01:22226983-22228209 (-)

Description Similar to BOP1: Ribosome biogenesis protein BOP1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47200`	UPF0481 protein At3g47200.	No verified direct reference in this release
`At3g02645`	Putative UPF0481 protein At3g02645.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038766 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006364 rRNA processing Biological Process

GO:0007276 gamete generation Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G40360

dosa:Os07g0435400

mbr:MONBRDRAFT_37129

mmu:12181

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.820

Rank 1 · TkA01G087240 · TK1151

Cytoplasm0.142

Rank 2 · TkA01G087240 · TK1151

Nucleus0.072

Rank 3 · TkA01G087240 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA01G087240 · TK1151

Extracellular0.025

Rank 5 · TkA01G087240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03140DUF2472-368 aa

PF00520Ion_trans120-157 aa

PF00520Ion_trans266-292 aa

PF00520Ion_trans343-371 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G087240	`PF03140`	DUF247	2	368	1.6e-83	282.0
TkA01G087240	`PF00520`	Ion_trans	120	157	0.57	10.0
TkA01G087240	`PF00520`	Ion_trans	266	292	0.57	10.0
TkA01G087240	`PF00520`	Ion_trans	343	371	0.57	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD53`	Arabidopsis thaliana	sp\|Q9SD53\|Y3720_ARATH UPF0481 protein At3g47200	21.500%	Swiss-Prot	Low
`P0C897`	Arabidopsis thaliana	sp\|P0C897\|Y3264_ARATH Putative UPF0481 protein At3g02645	28.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card