LXL04_038766 | RubberDandelionOmics

Gene overview

LXL04_038766

Reference: OH-1004 Chr: Chr09 Coordinates: 49976953-49981323 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1698 bp · LXL04_038766|LXL04_038766|OH1004|cDNA

ATGGAGTCTGGAGCAGCAGATATGATTGGTGATACCGTCAAACTTCTACTTAAATGTAAAGAAAATGGAGAGGTTCTTAACAAACAAGCGCCACCATCAATTTACATGGTTCCTACTATGCTCCGAGATCTCAGTCCAAGTTCTTTTACCCCTACGGTGGTCGCTATTGGCCCTCTTCACAGCCAAGATGAACATCTGCAAGAATTTGAAGTTCAGAAAACTGCTTATTTCCATAAGTGGTTGCATCGTTTGGGTATTAA...

CDS

Download CDS FASTA

1698 bp · LXL04_038766|LXL04_038766|OH1004|CDS

ATGGAGTCTGGAGCAGCAGATATGATTGGTGATACCGTCAAACTTCTACTTAAATGTAAAGAAAATGGAGAGGTTCTTAACAAACAAGCGCCACCATCAATTTACATGGTTCCTACTATGCTCCGAGATCTCAGTCCAAGTTCTTTTACCCCTACGGTGGTCGCTATTGGCCCTCTTCACAGCCAAGATGAACATCTGCAAGAATTTGAAGTTCAGAAAACTGCTTATTTCCATAAGTGGTTGCATCGTTTGGGTATTAA...

Protein

Download Protein FASTA

565 aa · LXL04_038766|LXL04_038766|OH1004|PROTEIN

MESGAADMIGDTVKLLLKCKENGEVLNKQAPPSIYMVPTMLRDLSPSSFTPTVVAIGPLHSQDEHLQEFEVQKTAYFHKWLHRLGINDDPEKTLRNYVEKVIHSIEGIKACYAGVMTYTDSELAKMMVIDACFILEFIQSHFILSGTLSGPNILIAQSIYLDILLIENQIPFFVLKIIFDCTILASGPMTDGSSLAKYIEVLVSGYYFIEEHVVEPDALSPDPDHILGFLHKYFQPAEPMPPTSPSSTKRHTAMELDRAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038766`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038766

Location Chr09:49976953-49981323 (+)

Description Similar to BOP1: Ribosome biogenesis protein BOP1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40360`	Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit (By similarity).	Analysis of Block of cell proliferation 1 (BOP1) activity in strawberry and Arabidopsis.2016 · DOI: 10.1016/j.plantsci.2016.01.002

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0435400`	Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038766 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000460 maturation of 5.8S rRNA Biological Process

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006364 rRNA processing Biological Process

GO:0007276 gamete generation Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G40360

dosa:Os07g0435400

mbr:MONBRDRAFT_37129

mmu:12181

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.803

Rank 1 · LXL04_038766 · OH-1004

Cytoplasm0.129

Rank 2 · LXL04_038766 · OH-1004

Endoplasmic reticulum0.070

Rank 3 · LXL04_038766 · OH-1004

Nucleus0.065

Rank 4 · LXL04_038766 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_038766 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03140.21DUF24734-431 aa

PF25172.2Beta-prop_WDR3_2nd448-563 aa

PF24814.2WD40_Prp19450-562 aa

PF00400.39WD40472-508 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038766	`PF03140.21`	DUF247	34	431	6.3e-90	303.1
LXL04_038766	`PF25172.2`	Beta-prop_WDR3_2nd	448	563	5.1e-06	26.6
LXL04_038766	`PF24814.2`	WD40_Prp19	450	562	6.2e-08	32.7
LXL04_038766	`PF00400.39`	WD40	472	508	2.5e-12	47.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IH25`	Arabidopsis thaliana	Ribosome biogenesis protein BOP1 homolog	78.261%	Swiss-Prot	weak database homology
`Q0D6V7`	Oryza sativa subsp. japonica	Ribosome biogenesis protein BOP1 homolog	80.702%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card