TkA01G083780 | RubberDandelionOmics

Gene overview

TkA01G083780

Reference: TK1151 Chr: Chr01 Coordinates: 21386638-21387548 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA01G083780|TK1151|cDNA

ATGGGTGACTTCATACACTGTTCACATGCTCATGCTTCCCAAACACGCGAGTTCGCCTCCTGCTCCAACATGTCCACTCCTACGAAGATTTATGTGAACGGAAGGTCGACGGCTATGTCGGAAGTTATCAGAAACAAAATCCCCTCGGTTCACGCTTTTGGAACTGCAATTGCCATCGATTCATACAAAATCGGCTCGGTTCACGCTCCGATGGCAACCCTATATCGATTGAGAGCAGCCGATAGCCCTATCAGGAATGT...

CDS

Download CDS FASTA

396 bp · TkA01G083780|TK1151|CDS

ATGGGTGACTTCATACACTGTTCACATGCTCATGCTTCCCAAACACGCGAGTTCGCCTCCTGCTCCAACATGTCCACTCCTACGAAGATTTATGTGAACGGAAGGTCGACGGCTATGTCGGAAGTTATCAGAAACAAAATCCCCTCGGTTCACGCTTTTGGAACTGCAATTGCCATCGATTCATACAAAATCGGCTCGGTTCACGCTCCGATGGCAACCCTATATCGATTGAGAGCAGCCGATAGCCCTATCAGGAATGT...

Protein

Download Protein FASTA

131 aa · TkA01G083780|TK1151|PROTEIN

MGDFIHCSHAHASQTREFASCSNMSTPTKIYVNGRSTAMSEVIRNKIPSVHAFGTAIAIDSYKIGSVHAPMATLYRLRAADSPIRNVSDARSLKIEGVKDIIVVASGKGGVGKSTTAGNFSNYGYFVVKLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G083780`
TK1151 ID	TkA01G083780
OH-1004 ID	LXL04_034090
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.500
Protein coverage (%)	TK1151 92.366 / OH-1004 56.034 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G083780`
Location	Chr01:21386638-21387548 (-)
Description	Similar to mrp: Iron-sulfur cluster carrier protein (Helicobacter pylori (strain J99 / ATCC 700824)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034090` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016226 iron-sulfur cluster assembly Biological Process GO:0032543 mitochondrial translation Biological Process GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0009507 chloroplast Cellular Component GO:0005524 ATP binding Molecular Function GO:0005543 phospholipid binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0046872 metal ion binding Molecular Function GO:0051536 iron-sulfur cluster binding Molecular Function
KEGG gene cross-reference	ath:AT4G19540 ddi:DDB_G0291193 dme:Dmel_CG3262 heo:C694_01035 hpj:jhp_0193 hpy:HP_0207 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.403

Rank 1 · TkA01G083780 · TK1151

Nucleus0.204

Rank 2 · TkA01G083780 · TK1151

Mitochondrion0.200

Rank 3 · TkA01G083780 · TK1151

Cytoplasm0.141

Rank 4 · TkA01G083780 · TK1151

Cell membrane0.064

Rank 5 · TkA01G083780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10609ParA21-41 aa

PF10609ParA98-120 aa

PF13614AAA_31101-121 aa

PF09140MipZ101-117 aa

PF01656CbiA102-121 aa

PF03668RapZ-like_N102-128 aa

PF02374ArsA_ATPase102-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G083780	`PF10609`	ParA	21	41	1.6e-05	25.2
TkA01G083780	`PF10609`	ParA	98	120	1.6e-05	25.2
TkA01G083780	`PF13614`	AAA_31	101	121	0.009	16.6
TkA01G083780	`PF09140`	MipZ	101	117	0.25	11.3
TkA01G083780	`PF01656`	CbiA	102	121	0.00083	20.0
TkA01G083780	`PF03668`	RapZ-like_N	102	128	0.13	12.8
TkA01G083780	`PF02374`	ArsA_ATPase	102	118	0.17	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card