TkA01G077980 | RubberDandelionOmics

Gene overview

TkA01G077980

Reference: TK1151 Chr: Chr01 Coordinates: 19921382-19921807 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkA01G077980|TK1151|cDNA

ATGATCTTGTCATTTGATATTACTAACGAGGAATTCAAATTGGTAGATCTCCCAGATAGATTCCGTACTGAACCTCGGAAGTATATCTCAATTTCTAAGATAGGTGAGTCTCTTGCTGTTATTGAAACCACATTTAGAGACACTTGTACAGAGGTTTGGATGATGGAAGATGGTGTTGAATTGTTCAAAAAGGTATTCAGTATAGAGGATCCAAGCAACATGATTGTGGGATTTAGGAGGAATGGTGTACCTATAATGGG...

CDS

Download CDS FASTA

426 bp · TkA01G077980|TK1151|CDS

ATGATCTTGTCATTTGATATTACTAACGAGGAATTCAAATTGGTAGATCTCCCAGATAGATTCCGTACTGAACCTCGGAAGTATATCTCAATTTCTAAGATAGGTGAGTCTCTTGCTGTTATTGAAACCACATTTAGAGACACTTGTACAGAGGTTTGGATGATGGAAGATGGTGTTGAATTGTTCAAAAAGGTATTCAGTATAGAGGATCCAAGCAACATGATTGTGGGATTTAGGAGGAATGGTGTACCTATAATGGG...

Protein

Download Protein FASTA

141 aa · TkA01G077980|TK1151|PROTEIN

MILSFDITNEEFKLVDLPDRFRTEPRKYISISKIGESLAVIETTFRDTCTEVWMMEDGVELFKKVFSIEDPSNMIVGFRRNGVPIMGVTNDDNEPCACVVYEPNSEHDNVLEMAPSPYSFNMNHYYMESLLFVDWSSSYSY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G077980`
TK1151 ID	TkA01G077980
OH-1004 ID	LXL04_005177
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 73.759 / OH-1004 17.568 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G077980`
Location	Chr01:19921382-19921807 (-)
Description	Similar to At1g47790: Putative F-box protein At1g47790
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005177` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006952 defense response Biological Process GO:0009617 response to bacterium Biological Process GO:0009620 response to fungus Biological Process GO:0016567 protein ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0019005 SCF ubiquitin ligase complex Cellular Component
KEGG gene cross-reference	ath:AT1G47730 ath:AT1G47790 ath:AT1G50870 ath:AT2G17310 ath:AT3G23880 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.612

Rank 1 · TkA01G077980 · TK1151

Nucleus0.443

Rank 2 · TkA01G077980 · TK1151

Cell membrane0.085

Rank 3 · TkA01G077980 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA01G077980 · TK1151

Extracellular0.052

Rank 5 · TkA01G077980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268FBA_31-74 aa

PF07734FBA_12-67 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G077980	`PF08268`	FBA_3	1	74	0.00057	19.7
TkA01G077980	`PF07734`	FBA_1	2	67	0.00021	21.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card