LXL04_005177 | RubberDandelionOmics

Gene overview

LXL04_005177

Reference: OH-1004 Chr: Chr01 Coordinates: 157199416-157202681 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1779 bp · LXL04_005177|LXL04_005177|OH1004|cDNA

ATGACTCCAGTATCACCGGTAATGAAAATGTCCGATAATCATCTACCTTTCCACATTCAAGAGGAAATCATGAAAAGACTTCCCGTGAAATCATTGGTTCAGTTCAGATCCGTCTCAAAATCATGGAAGTCATTGATCGACAGAGTTTATCGCTGCTCACACTCTCCGCCGCCGTACTCAGCCGCAACATCTACTTCTATGGGAAATGGCATCCGTCCAACAATCTTCCAACCGCACCAATTCATGGATGGTCCTCGGTT...

CDS

Download CDS FASTA

1779 bp · LXL04_005177|LXL04_005177|OH1004|CDS

ATGACTCCAGTATCACCGGTAATGAAAATGTCCGATAATCATCTACCTTTCCACATTCAAGAGGAAATCATGAAAAGACTTCCCGTGAAATCATTGGTTCAGTTCAGATCCGTCTCAAAATCATGGAAGTCATTGATCGACAGAGTTTATCGCTGCTCACACTCTCCGCCGCCGTACTCAGCCGCAACATCTACTTCTATGGGAAATGGCATCCGTCCAACAATCTTCCAACCGCACCAATTCATGGATGGTCCTCGGTT...

Protein

Download Protein FASTA

592 aa · LXL04_005177|LXL04_005177|OH1004|PROTEIN

MTPVSPVMKMSDNHLPFHIQEEIMKRLPVKSLVQFRSVSKSWKSLIDRVYRCSHSPPPYSAATSTSMGNGIRPTIFQPHQFMDGPRLLPTDLPDRFRTEPRKYISISKIGESLAVIETTFRDTCTEVWMMEDGVELFKKVFSIEDPSNMIVGFRRNGVPIMGVTNDDNEPCACVVYEPNSEHDNVLEMAPSPYSVRFLQSAADFDSNFYSTRLIDPGIHRCVFTAANCCCSAAPASPVIKMSENHIPSHIQEEIMKRLPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005177`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005177

Location Chr01:157199416-157202681 (+)

Description Similar to At1g47790: Putative F-box protein At1g47790

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At1g47730`	Putative F-box protein At1g47730.	No verified direct reference in this release
`At2g17310`	Negatively regulates a plant defense signaling pathway which is independent of salicylic acid (SA) and systemic acquired resistance (SAR).	Arabidopsis SON1 is an F-box protein that regulates a novel induced defense response independent of both salicylic acid and systemic acquired resistance.2002 · DOI: 10.1105/tpc.001867
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At1g50870`	Putative F-box protein At1g50870.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005177 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT1G47730

ath:AT1G47790

ath:AT1G50870

ath:AT2G17310

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.625

Rank 1 · LXL04_005177 · OH-1004

Nucleus0.398

Rank 2 · LXL04_005177 · OH-1004

Cell membrane0.101

Rank 3 · LXL04_005177 · OH-1004

Endoplasmic reticulum0.074

Rank 4 · LXL04_005177 · OH-1004

Extracellular0.056

Rank 5 · LXL04_005177 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937.13F-box-like13-50 aa

PF00646.39F-box14-51 aa

PF00646.39F-box245-282 aa

PF12937.13F-box-like245-279 aa

PF07734.19FBA_1334-521 aa

PF08268.18FBA_3337-512 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005177	`PF12937.13`	F-box-like	13	50	2.3e-12	47.2
LXL04_005177	`PF00646.39`	F-box	14	51	2.2e-23	81.9
LXL04_005177	`PF00646.39`	F-box	245	282	2.2e-23	81.9
LXL04_005177	`PF12937.13`	F-box-like	245	279	2.3e-12	47.2
LXL04_005177	`PF07734.19`	FBA_1	334	521	1.9e-13	50.9
LXL04_005177	`PF08268.18`	FBA_3	337	512	1.5e-11	44.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZF8`	Arabidopsis thaliana	Putative F-box protein At1g47790	24.823%	Swiss-Prot	weak database homology
`Q9SXA0`	Arabidopsis thaliana	Putative F-box protein At1g47730	25.260%	Swiss-Prot	weak database homology
`Q8LL17`	Arabidopsis thaliana	Protein SUPPRESSOR OF NIM1 1	24.859%	Swiss-Prot	weak database homology
`Q9LIR8`	Arabidopsis thaliana	F-box/kelch-repeat protein At3g23880	25.402%	Swiss-Prot	weak database homology
`Q9C6J3`	Arabidopsis thaliana	Putative F-box protein At1g50870	26.971%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card