TkA01G077970 | RubberDandelionOmics

Gene overview

TkA01G077970

Reference: TK1151 Chr: Chr01 Coordinates: 19918455-19920866 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2147 bp · TkA01G077970|TK1151|cDNA

TTTTGACCAAATTAGTGCACAAACTCATCATTTGTACGTTTAAGTGGAAAAAATCCTAAGCTCGGCCGAATAAGACCATCGTAAACGACGACTCCAACGATTTGATCCCTTAAAATTCCAAATACCAGATCCAACTTCCAGGGACGGCATGAGGCGGGAACGAGACTGTTAAAAGGGCTGAATCGTAATCATCGTCGCAAGCAGAGTTCGATTTCTTCAATCGGCTGCCGATTTTGACTCTAATTTCTATTCTACTCGGC...

CDS

Download CDS FASTA

1059 bp · TkA01G077970|TK1151|CDS

ATGTCCGAAAACCACATACCTTCTCATATTCAAGAGGAAATCATGAAAAGACTTCCCGTAAAATCATTACTTCAGTTCAGATCCGTCTCAAAAACATGGAAGTCATTAATCGACAGCTCTAAGTTCATTACTTCTCACACTCTCCACCACCATACTCACCCTCACCATCTGCTCATATGGTACTGGGACCAAACAGACCAGATAAACTACATTTGTGGTGTAGACGATTACACTTTCCCCCAAAAGAGATACACTCCAAC...

Protein

Download Protein FASTA

352 aa · TkA01G077970|TK1151|PROTEIN

MSENHIPSHIQEEIMKRLPVKSLLQFRSVSKTWKSLIDSSKFITSHTLHHHTHPHHLLIWYWDQTDQINYICGVDDYTFPQKRYTPTLPQSIKQLKLARVVGSSHGLLCFYGYIPDFKTKLAVLWNPSIRKYINVPVPGESSLSFGVCPTTHNPKIIAITQSRDFTHCEVMIYTLSSGKWNPSSNFPDTPIRDVWSSVVTNRFIYWIAGLDPKLIMSFDVTNEKFKLVDLPDSLARDPPRFLSISKIGECLSVLENRENI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G077970`
TK1151 ID	TkA01G077970
OH-1004 ID	LXL04_005177
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 59.459 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G077970

Location Chr01:19918455-19920866 (-)

Description Similar to At1g47790: Putative F-box protein At1g47790

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At1g47730`	Putative F-box protein At1g47730.	No verified direct reference in this release
`At1g50870`	Putative F-box protein At1g50870.	No verified direct reference in this release
`At2g21930`	F-box protein At2g21930.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005177 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

KEGG gene cross-reference

ath:AT1G47730

ath:AT1G47790

ath:AT1G50870

ath:AT2G17310

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.686

Rank 1 · TkA01G077970 · TK1151

Nucleus0.379

Rank 2 · TkA01G077970 · TK1151

Cell membrane0.102

Rank 3 · TkA01G077970 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA01G077970 · TK1151

Lysosome / Vacuole0.039

Rank 5 · TkA01G077970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box5-42 aa

PF12937F-box-like5-40 aa

PF07734FBA_189-283 aa

PF08268FBA_393-271 aa

PF2673303009_C245-278 aa

PF19247DUF5895295-327 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G077970	`PF00646`	F-box	5	42	1.5e-11	44.4
TkA01G077970	`PF12937`	F-box-like	5	40	5.1e-05	23.7
TkA01G077970	`PF07734`	FBA_1	89	283	7.7e-14	52.1
TkA01G077970	`PF08268`	FBA_3	93	271	2.8e-14	53.6
TkA01G077970	`PF26733`	03009_C	245	278	0.073	13.7
TkA01G077970	`PF19247`	DUF5895	295	327	0.1	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZF8`	Arabidopsis thaliana	sp\|Q9FZF8\|FB44_ARATH Putative F-box protein At1g47790	25.800%	Swiss-Prot	Low
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	25.500%	Swiss-Prot	Low
`Q9SXA0`	Arabidopsis thaliana	sp\|Q9SXA0\|FB42_ARATH Putative F-box protein At1g47730	25.300%	Swiss-Prot	Low
`Q9C6J3`	Arabidopsis thaliana	sp\|Q9C6J3\|FB52_ARATH Putative F-box protein At1g50870	28.200%	Swiss-Prot	Low
`Q9SJ06`	Arabidopsis thaliana	sp\|Q9SJ06\|FB115_ARATH F-box protein At2g21930	28.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card