TkA01G069910 | RubberDandelionOmics

Gene overview

TkA01G069910

Reference: TK1151 Chr: Chr01 Coordinates: 17894059-17894699 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · TkA01G069910|TK1151|cDNA

ATGAAATTTTTCTCTACTTTTTCCAGAATGGCTTCAAAACAAAAATTCGATTCTCGTACAAAGCGGTGCAACTGTGCAACAAGCAATTGCGCGAATCGTTACTGTGTTTGCTATTCTAATGGAAGAACTTGTAGCACATCTTGCTCATGCCATGAATGTTTCAATCGAATTTCATCTTCATTATCCACGGAGGAAGGTCGAAAAAGACAGAAGATAGGCTGCAATTGTGTGGCGAATCAGTGCACGCGTATGTTATGTAG...

CDS

Download CDS FASTA

390 bp · TkA01G069910|TK1151|CDS

ATGAAATTTTTCTCTACTTTTTCCAGAATGGCTTCAAAACAAAAATTCGATTCTCGTACAAAGCGGTGCAACTGTGCAACAAGCAATTGCGCGAATCGTTACTGTGTTTGCTATTCTAATGGAAGAACTTGTAGCACATCTTGCTCATGCCATGAATGTTTCAATCGAATTTCATCTTCATTATCCACGGAGGAAGGTCGAAAAAGACAGAAGATAGGCTGCAATTGTGTGGCGAATCAGTGCACGCGTATGTTATGTAG...

Protein

Download Protein FASTA

129 aa · TkA01G069910|TK1151|PROTEIN

MKFFSTFSRMASKQKFDSRTKRCNCATSNCANRYCVCYSNGRTCSTSCSCHECFNRISSSLSTEEGRKRQKIGCNCVANQCTRMLCSCVKAGVACTNRCRCERCENVNGKRGDNFEVKSDTSLDLKLSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G069910`
TK1151 ID	TkA01G069910
OH-1004 ID	LXL04_005288
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	69.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G069910`
Location	Chr01:17894059-17894699 (-)
Description	Similar to TSO1: CRC domain-containing protein TSO1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005288` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006355 regulation of DNA-templated transcription Biological Process GO:0009934 regulation of meristem structural organization Biological Process GO:0010235 guard mother cell cytokinesis Biological Process GO:0010375 stomatal complex patterning Biological Process GO:0010440 stomatal lineage progression Biological Process GO:0010481 epidermal cell division Biological Process GO:0048444 floral organ morphogenesis Biological Process GO:0051302 regulation of cell division Biological Process GO:0005634 nucleus Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT3G22760 ath:AT3G22780 ath:AT4G14770 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · TkA01G069910 · TK1151

Cytoplasm0.179

Rank 2 · TkA01G069910 · TK1151

Mitochondrion0.017

Rank 3 · TkA01G069910 · TK1151

Cell membrane0.016

Rank 4 · TkA01G069910 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA01G069910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03638TCR21-56 aa

PF03638TCR72-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G069910	`PF03638`	TCR	21	56	2.1e-16	60.6
TkA01G069910	`PF03638`	TCR	72	107	2.1e-16	60.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card