LXL04_005288 | RubberDandelionOmics

Gene overview

LXL04_005288

Reference: OH-1004 Chr: Chr01 Coordinates: 159711424-159712064 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · LXL04_005288|LXL04_005288|OH1004|cDNA

ATGAAATTTTTCTCTACTTTTTCCAGAATGGCTTCAAAACAAAAATTCGATTCTCGTACAAAGCGGTGCAACTGTGCAACAAGCAATTGCGCGAATCGTGGCGCCATTTCATTCGCAGTTACTGTGTTTGCTATTCTAATGGAAGAACTTGTAGCACATCTTGCTCATGCCATGAATGTTTCAATCGAATTTCATCTTCATTATCCACGGAGGTTTACTCTCTCGTATAGTGAAGGTCGAAAAAGACAGAAGATAGGCTG...

CDS

Download CDS FASTA

429 bp · LXL04_005288|LXL04_005288|OH1004|CDS

ATGAAATTTTTCTCTACTTTTTCCAGAATGGCTTCAAAACAAAAATTCGATTCTCGTACAAAGCGGTGCAACTGTGCAACAAGCAATTGCGCGAATCGTGGCGCCATTTCATTCGCAGTTACTGTGTTTGCTATTCTAATGGAAGAACTTGTAGCACATCTTGCTCATGCCATGAATGTTTCAATCGAATTTCATCTTCATTATCCACGGAGGTTTACTCTCTCGTATAGTGAAGGTCGAAAAAGACAGAAGATAGGCTG...

Protein

Download Protein FASTA

142 aa · LXL04_005288|LXL04_005288|OH1004|PROTEIN

MKFFSTFSRMASKQKFDSRTKRCNCATSNCANRGAISFAVTVFAILMEELVAHLAHAMNVSIEFHLHYPRRFTLSYSEGRKRQKIGCNCVANQCMRILCSCVKAGVGCTNRCRCERCENVNGKRGDNFEVKSDTSLDLKLSI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005288`
TK1151 ID	TkA01G069910
OH-1004 ID	LXL04_005288
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	69.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005288

Location Chr01:159711424-159712064 (+)

Description Similar to TSO1: CRC domain-containing protein TSO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g22780`	Probable floral-specific cell division component, required for proper organ formation in flowers.	Regulation of meristem organization and cell division by TSO1, an Arabidopsis gene with cysteine-rich repeats.2000 · DOI: 10.1242/dev.127.10.2207 TSO1 is a novel protein that modulates cytokinesis and cell expansion in Arabidopsis.2000 · DOI: 10.1242/dev.127.10.2219 TSO1 functions in cell division during Arabidopsis flower development.1997 · DOI: 10.1242/dev.124.3.665 Arabidopsis TSO1 regulates directional processes in cells during floral organogenesis.1998 · DOI: 10.1093/genetics/150.1.411
`At3g22760`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release
`At4g14770`	Plays a role in development of both male and female reproductive tissues.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005288 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010235 guard mother cell cytokinesis Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0010481 epidermal cell division Biological Process

GO:0048444 floral organ morphogenesis Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G22760

ath:AT3G22780

ath:AT4G14770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.676

Rank 1 · LXL04_005288 · OH-1004

Cytoplasm0.307

Rank 2 · LXL04_005288 · OH-1004

Mitochondrion0.058

Rank 3 · LXL04_005288 · OH-1004

Cell membrane0.047

Rank 4 · LXL04_005288 · OH-1004

Endoplasmic reticulum0.035

Rank 5 · LXL04_005288 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03638.22TCR85-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005288	`PF03638.22`	TCR	85	120	3.8e-07	31.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUI3`	Arabidopsis thaliana	CRC domain-containing protein TSO1	39.683%	Swiss-Prot	weak database homology
`Q8L548`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 3	42.857%	Swiss-Prot	weak database homology
`F4JIF5`	Arabidopsis thaliana	Protein tesmin/TSO1-like CXC 2	42.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card