TkA01G069480 | RubberDandelionOmics

Gene overview

TkA01G069480

Reference: TK1151 Chr: Chr01 Coordinates: 17791883-17803589 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2055 bp · TkA01G069480|TK1151|cDNA

ATTGCTAAAGACAAAGAGACTTCGCAGTCGGCTTTGTCGACTCTAACCCCCAAACATCTTGATGAAATAATCGAAACCTACCATATTCCTCGCGATAAAAACCCTGTTCTTCCTGTTTACGGGCAAACTATCCACAATCCTCCGGCTGGGCTTGTAGGTGTATATCACCATCATCTGAAAGGTGGTCTCCGATTTCCCGTTCACGGCTTTGTTTCTGTTGTCACGTCTCATTACGGAGTTCATCTGGTACAAATTGTTCC...

CDS

Download CDS FASTA

2055 bp · TkA01G069480|TK1151|CDS

ATTGCTAAAGACAAAGAGACTTCGCAGTCGGCTTTGTCGACTCTAACCCCCAAACATCTTGATGAAATAATCGAAACCTACCATATTCCTCGCGATAAAAACCCTGTTCTTCCTGTTTACGGGCAAACTATCCACAATCCTCCGGCTGGGCTTGTAGGTGTATATCACCATCATCTGAAAGGTGGTCTCCGATTTCCCGTTCACGGCTTTGTTTCTGTTGTCACGTCTCATTACGGAGTTCATCTGGTACAAATTGTTCC...

Protein

Download Protein FASTA

684 aa · TkA01G069480|TK1151|PROTEIN

IAKDKETSQSALSTLTPKHLDEIIETYHIPRDKNPVLPVYGQTIHNPPAGLVGVYHHHLKGGLRFPVHGFVSVVTSHYGVHLVQIVPNGVRKILCFIFICKVLNISPSLDLFRYFYVASPSREWLSFSKRTRSAELCPGLPSSIKRWKNEFFFVDSSLYPAGMKLGSLSSRSSDRALKLAAEEQAVADRLTANAIWWADPDEITLGLAGCSPKWDSLNPKPSLVGDEKGATLADRLTFLQDMSADDVIGVSSETIATSSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G069480`
TK1151 ID	TkA01G069480
OH-1004 ID	LXL04_013725
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	42.800
Protein coverage (%)	TK1151 96.637 / OH-1004 46.810 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G069480`
Location	Chr01:17791883-17803589 (+)
Description	Similar to SCL15: Scarecrow-like protein 15
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013725` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0007623 circadian rhythm Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process GO:0010187 negative regulation of seed germination Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0030154 cell differentiation Biological Process GO:0036377 arbuscular mycorrhizal association Biological Process
KEGG gene cross-reference	ath:AT2G45160 ath:AT3G60630 ath:AT4G00150 ath:AT4G36710 mtr:25489240 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.864

Rank 1 · TkA01G069480 · TK1151

Cytoplasm0.237

Rank 2 · TkA01G069480 · TK1151

Mitochondrion0.023

Rank 3 · TkA01G069480 · TK1151

Cell membrane0.017

Rank 4 · TkA01G069480 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA01G069480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04195Transposase_2855-118 aa

PF09320DUF1977558-610 aa

PF23353BBS2_hp593-633 aa

PF23204KIF21A_2nd601-680 aa

PF19443DAHL602-676 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G069480	`PF04195`	Transposase_28	55	118	7e-15	55.7
TkA01G069480	`PF09320`	DUF1977	558	610	0.24	12.3
TkA01G069480	`PF23353`	BBS2_hp	593	633	0.37	11.6
TkA01G069480	`PF23204`	KIF21A_2nd	601	680	0.37	11.7
TkA01G069480	`PF19443`	DAHL	602	676	0.034	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card