TkA01G067010 | RubberDandelionOmics

Gene overview

TkA01G067010

Reference: TK1151 Chr: Chr01 Coordinates: 17123861-17126738 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2791 bp · TkA01G067010|TK1151|cDNA

TTGAAAGTTGACACTAAACTGGTGACGTAAGACGTTCTTACTTCTTTGACCTCTGCACACACGAATTCACCTACTCACCTAGTATTCTTCTTCTTAATCTTTCCACCTGCAAATCGATACTTTCTCAATCTACATAAATTCTTCTTCTTCTTCTCTCTCTAGATTGACATCTTTATCTTTCTCTCTTTCTCTTTCATGGTGGAAAACCGCATATAAGCGAACACAGAGGTTTCTGTAATCTGTACACATGTTTCGCTTTT...

CDS

Download CDS FASTA

2343 bp · TkA01G067010|TK1151|CDS

ATGCGAACATGGGGATTCTCGTGTTTCGTGATTACCTTTTGGATCTTTCTGTTCTTACCTCAAACATGCATATCAAGTGTTCGACAAAATGGCAAAGTGAGTCCGGGATTCGAAGCCTCACAAATGCGGTACATAGACAACAGCGGTTTGTTCCTGGTATCAAACTCATCGAATTTCGGATTCGGTTTCAATCCCAATAGTGACGTCACTTCATTCACTTTAGTCGTCATTCACATGACCAGTTCAACGATCATCTGGTC...

Protein

Download Protein FASTA

780 aa · TkA01G067010|TK1151|PROTEIN

MRTWGFSCFVITFWIFLFLPQTCISSVRQNGKVSPGFEASQMRYIDNSGLFLVSNSSNFGFGFNPNSDVTSFTLVVIHMTSSTIIWSANRGSPVGISDTFLFDDDGNASLQKNGKVVWSTNTAKNGVSAMELRDSGNLVLVNNDGGVVWQSFSHPTNTLTSNQSFIKGMKLVSNVNNNLSFSLEIENNDLILSAEFKNPQPYWSIGKDKRKIINKNGGDTNSATIEGNSWRMYDENGTFLSQFVFADDSDANDSATWVAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G067010`
TK1151 ID	TkA01G067010
OH-1004 ID	LXL04_005317
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 96.310 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G067010

Location Chr01:17123861-17126738 (+)

Description Similar to SD25: G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5.	No verified direct reference in this release
`At5g35370`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370.	No verified direct reference in this release
`At1g34300`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300.	No verified direct reference in this release
`At2g19130`	G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130.	No verified direct reference in this release
`At5g24080`	G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005317 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046777 protein autophosphorylation Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0031625 ubiquitin protein ligase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G34300

ath:AT2G19130

ath:AT4G32300

ath:AT5G24080

ath:AT5G35370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.807

Rank 1 · TkA01G067010 · TK1151

Endoplasmic reticulum0.087

Rank 2 · TkA01G067010 · TK1151

Cytoplasm0.082

Rank 3 · TkA01G067010 · TK1151

Extracellular0.051

Rank 4 · TkA01G067010 · TK1151

Nucleus0.048

Rank 5 · TkA01G067010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin83-177 aa

PF01453B_lectin243-268 aa

PF01683EB281-315 aa

PF08276PAN_2286-305 aa

PF08277PAN_3349-386 aa

PF08276PAN_2349-371 aa

PF00024PAN_1355-390 aa

PF01683EB360-381 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G067010	`PF01453`	B_lectin	83	177	4.5e-16	59.9
TkA01G067010	`PF01453`	B_lectin	243	268	4.5e-16	59.9
TkA01G067010	`PF01683`	EB	281	315	0.0014	19.4
TkA01G067010	`PF08276`	PAN_2	286	305	0.025	15.4
TkA01G067010	`PF08277`	PAN_3	349	386	8.5e-05	23.0
TkA01G067010	`PF08276`	PAN_2	349	371	0.025	15.4
TkA01G067010	`PF00024`	PAN_1	355	390	0.0003	21.3
TkA01G067010	`PF01683`	EB	360	381	0.0014	19.4
TkA01G067010	`PF07714`	PK_Tyr_Ser-Thr	467	728	1.7e-45	156.0
TkA01G067010	`PF00069`	Pkinase	469	726	2.4e-51	175.4
TkA01G067010	`PF03109`	ABC1	470	494	0.00028	20.9
TkA01G067010	`PF01636`	APH	512	611	0.02	15.4
TkA01G067010	`PF03109`	ABC1	531	616	0.00028	20.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWZ5`	Arabidopsis thaliana	sp\|Q8RWZ5\|SD25_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5	54.400%	Swiss-Prot	High
`O65238`	Arabidopsis thaliana	sp\|O65238\|Y5537_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370	33.900%	Swiss-Prot	Medium
`Q9XID3`	Arabidopsis thaliana	sp\|Q9XID3\|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300	36.000%	Swiss-Prot	Medium
`O64477`	Arabidopsis thaliana	sp\|O64477\|Y2913_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130	34.600%	Swiss-Prot	Medium
`Q9FLV4`	Arabidopsis thaliana	sp\|Q9FLV4\|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080	55.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card