TkA01G064070 | RubberDandelionOmics

Gene overview

TkA01G064070

Reference: TK1151 Chr: Chr01 Coordinates: 16494072-16494461 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · TkA01G064070|TK1151|cDNA

CTTATTTACTTCCTATATAAACCCAAAGTTTCTGAATCCACACAATCCCCCGCATCAGAACCAAGTGTTGGCTTCAACCTCAACTATGATCCACCACAACCCATGGGTCGTGATGAAGCAAAGCGAAAGAAGAGAGGCAAAAACATAGCCACTAGCACTACTAGCACACATAGTAGTGTTCAAGAAGATATGGTCGCTTTGTCCGGCAATGTTGAGACATACAAGGAAGCTCAGCAGATCAAAGAGTCTGCCTGGAAAAT...

CDS

Download CDS FASTA

390 bp · TkA01G064070|TK1151|CDS

CTTATTTACTTCCTATATAAACCCAAAGTTTCTGAATCCACACAATCCCCCGCATCAGAACCAAGTGTTGGCTTCAACCTCAACTATGATCCACCACAACCCATGGGTCGTGATGAAGCAAAGCGAAAGAAGAGAGGCAAAAACATAGCCACTAGCACTACTAGCACACATAGTAGTGTTCAAGAAGATATGGTCGCTTTGTCCGGCAATGTTGAGACATACAAGGAAGCTCAGCAGATCAAAGAGTCTGCCTGGAAAAT...

Protein

Download Protein FASTA

129 aa · TkA01G064070|TK1151|PROTEIN

LIYFLYKPKVSESTQSPASEPSVGFNLNYDPPQPMGRDEAKRKKRGKNIATSTTSTHSSVQEDMVALSGNVETYKEAQQIKESAWKIKEKMQLRKIIQEDISNKTGFEYEFALQMKKDAARQLGYHIDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G064070`
TK1151 ID	TkA01G064070
OH-1004 ID	LXL04_005326
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.600
Protein coverage (%)	TK1151 96.124 / OH-1004 15.365 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G064070`
Location	Chr01:16494072-16494461 (-)
Description	Similar to At5g34940: Heparanase-like protein 3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005326` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009826 unidimensional cell growth Biological Process GO:0005576 extracellular region Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0004566 beta-glucuronidase activity Molecular Function
KEGG gene cross-reference	ath:AT5G07830 ath:AT5G34940 ath:AT5G61250 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.945

Rank 1 · TkA01G064070 · TK1151

Cytoplasm0.188

Rank 2 · TkA01G064070 · TK1151

Mitochondrion0.019

Rank 3 · TkA01G064070 · TK1151

Extracellular0.015

Rank 4 · TkA01G064070 · TK1151

Cell membrane0.013

Rank 5 · TkA01G064070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14303NAM-associated10-117 aa

PF25509DUF791622-98 aa

PF14318Mononeg_mRNAcap38-116 aa

PF04972BON59-88 aa

PF00874PRD83-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G064070	`PF14303`	NAM-associated	10	117	0.028	16.0
TkA01G064070	`PF25509`	DUF7916	22	98	0.00085	19.2
TkA01G064070	`PF14318`	Mononeg_mRNAcap	38	116	0.038	14.1
TkA01G064070	`PF04972`	BON	59	88	0.032	15.3
TkA01G064070	`PF00874`	PRD	83	129	0.17	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card