LXL04_005326 | RubberDandelionOmics

Gene overview

LXL04_005326

Reference: OH-1004 Chr: Chr01 Coordinates: 160439757-160445300 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2385 bp · LXL04_005326|LXL04_005326|OH1004|cDNA

ATGGTCATCAAATTCAGAAATGTTGAACTCCGGCCAAAGTGGTCGGCAATTGAGATAGGTTTACTGATAGGCACAACGGGGTTGTTTTTGGTGATGATGATATTATTCAAAACGATTTTATTTGAAGAAAAAGTGGGATTTATAGTGGGGAACGTGAATGTAAACGGAACATCATCGGTGGGTTTCATTGATGAAGATTTCGTGTGTGCCACTTTGGATTGGTGGCCACCTGAAAAATGCGATTATGGAAGTTGTAGTTG...

CDS

Download CDS FASTA

2385 bp · LXL04_005326|LXL04_005326|OH1004|CDS

ATGGTCATCAAATTCAGAAATGTTGAACTCCGGCCAAAGTGGTCGGCAATTGAGATAGGTTTACTGATAGGCACAACGGGGTTGTTTTTGGTGATGATGATATTATTCAAAACGATTTTATTTGAAGAAAAAGTGGGATTTATAGTGGGGAACGTGAATGTAAACGGAACATCATCGGTGGGTTTCATTGATGAAGATTTCGTGTGTGCCACTTTGGATTGGTGGCCACCTGAAAAATGCGATTATGGAAGTTGTAGTTG...

Protein

Download Protein FASTA

794 aa · LXL04_005326|LXL04_005326|OH1004|PROTEIN

MVIKFRNVELRPKWSAIEIGLLIGTTGLFLVMMILFKTILFEEKVGFIVGNVNVNGTSSVGFIDEDFVCATLDWWPPEKCDYGSCSWGTSSLLNLVSFFSLHYFLISGLDGVEVAKTSPSSSPSSPRPHPAASPSSSLFKPSRLRLLLSESVEQRWNHFMTVERLLYQAQYGSQFTQDVFWRAVKDYEKWRELESFDQFVIHLAKKHKVSESPSSEPSVQGFNLNYDPPQPMGRDEAKRKKRGKSIATSTTSTNSSVQEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005326`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005326

Location Chr01:160439757-160445300 (-)

Description Similar to At5g34940: Heparanase-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g34940`	Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme.	No verified direct reference in this release
`At5g07830`	Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme.	No verified direct reference in this release
`At5g61250`	Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005326 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009826 unidimensional cell growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0004566 beta-glucuronidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G07830

ath:AT5G34940

ath:AT5G61250

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.232

Rank 1 · LXL04_005326 · OH-1004

Endoplasmic reticulum0.209

Rank 2 · LXL04_005326 · OH-1004

Cell membrane0.176

Rank 3 · LXL04_005326 · OH-1004

Cytoplasm0.143

Rank 4 · LXL04_005326 · OH-1004

Extracellular0.130

Rank 5 · LXL04_005326 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03662.21Glyco_hydro_79n51-95 aa

PF03662.21Glyco_hydro_79n331-601 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005326	`PF03662.21`	Glyco_hydro_79n	51	95	6.3e-139	463.1
LXL04_005326	`PF03662.21`	Glyco_hydro_79n	331	601	6.3e-139	463.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZP1`	Arabidopsis thaliana	Heparanase-like protein 3	57.235%	Swiss-Prot	moderate database homology
`Q9FF10`	Arabidopsis thaliana	Heparanase-like protein 1	45.397%	Swiss-Prot	moderate database homology
`Q8L608`	Arabidopsis thaliana	Heparanase-like protein 2	45.299%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card